- Search results for 5777-1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "5777-1"!
Close filters
Filter by:
No results were found for the filter!
Item number: Cay35777-1
BMS-299897 is an inhibitor of gamma-secretase. It selectively cleaves the carboxy terminal fragment (CTF) of amyloid precursor protein (APP) over the Notch-1 CTF in HEK293 cells (IC50s = 7.1 and 105.9 nM, respectively). BMS-299897 (0.1-1 nmol/animal) reduces increases in amyloid-beta (1-42) (Abeta42) levels induced...
Keywords: | 2-[(1R)-1-[[(4-chlorophenyl)sulfonyl](2,5-difluorophenyl)amino]ethyl]-5-fluoro-benzenebutanoic acid |
Application: | Gamma-secretase inhibitor |
CAS | 290315-45-6 |
MW: | 511.9 D |
From 39.00€
*
Item number: VMPS-5777
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Selw, SelW, Sepw1, Selenoprotein W |
Application: | RNA quantification |
43.00€
*
Item number: 225777.100
Application: | IF, IHC, WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 516.00€
*
Item number: 375777.100
Source:, Recombinant protein corresponding to aa1-44 from human C4orf3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.8kD, AA Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing...
Keywords: | C4orf3, Uncharacterized protein C4orf3, HCV F-transactivated protein 1, Hepatitis C virus F protein-transactivated protein 1 |
MW: | 20,8 |
From 511.00€
*
Item number: LKT-M185777.100
4-(Methylsulfinyl) butylamine is the synthetic precursor of sulforaphane.
Keywords: | Schembl371434, CTK7E8172, 4-methanesulfinylbutan-1-amine, (+/-)-1-amino-4-(methylsulfinyl)butane,... |
Application: | Synthetic sulforaphane precursor |
CAS | 187587-70-8 |
MW: | 135.23 D |
From 77.00€
*
Item number: Cay25777-100
Sabinene is a bicyclic monoterpene found in a variety of plants, including Cannabis, that has antifungal and anti-inflammatory properties. It inhibits the growth of various fungi in vitro, including several species of Candida, Trichophyton, and Aspergillus (MICs = 0.16-5 µl/ml). Sabinene (0.32 µl/ml) prevents...
Keywords: | NSC 407278, 4-methylene-1-(1-methylethyl)-bicyclo[3.1.0]hexane |
Application: | Bioactive bicyclic monoterpene, Antifungal, Antiinflammatory |
CAS | 3387-41-5 |
MW: | 136.2 D |
From 80.00€
*
Item number: 517777.100
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane...
Keywords: | LamR, 67LR, LAMBR, 37LRP, LRP/LR, LBP/p40, NEM/1CHD4, Laminin receptor 1, 67 kDa laminin receptor, 40S ribosomal protein... |
Expressed in: | E.coli |
Origin: | human |
MW: | 37.7 kD |
From 575.00€
*
Item number: Cay14747-1
Cucurbitacin I is triterpenoid compound that acts as a potent inhibitor of the STAT3/JAK signaling pathway. It specifically suppresses levels of tyrosine phosphorylated STAT3 in v-Src-transformed NIH 3T3 cells and in A549 cells (IC50 = 500 nM) resulting in inhibition of STAT3 DNA binding and reduced STAT3-mediated...
Keywords: | Elatericin B, JSI-124, NSC 521777,... |
Application: | STAT3/JAK signaling pathway inhibitor |
CAS | 2222-07-3 |
MW: | 514.7 D |
From 129.00€
*
Item number: Cay11747-5
Tipifarnib is a nonpeptidomimetic, CAAX-competitive inhibitor of farnesyltransferase (IC50 = 0.86 nM). It prevents farnesylation of Ras GTPases and has shown potent efficacy in various in vitro and in vivo tumor models.Formal Name:...
Keywords: | R 115777, 6-[(R)-amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone |
Application: | CAAX-competitive farnesyltransferase inhibitor, Ras GTPase farnesylation inhibitor |
CAS | 192185-72-1 |
MW: | 489.4 D |
From 60.00€
*
Item number: Cay35515-1
(S)-Tipifarnib is an inactive enantiomer of tipifarnib (Cay-11747).Formal Name: 6-[(S)-amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone. CAS Number: 192185-71-0. Synonyms: (S)-(-)-R 115777. Molecular Formula: C27H22Cl2N4O. Formula Weight: 489.4. Purity: >98%....
Keywords: | (S)-(-)-R 115777,... |
Application: | Inactive enantiomer |
CAS | 192185-71-0 |
MW: | 489.4 D |
From 69.00€
*
Item number: NSJ-RQ5777
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TUBB1 is a gene that codes for the protein Tubulin beta-1 chain in humans. This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form...
Keywords: | Anti-TUBB1, Anti-Tubulin beta-1 chain, Beta Tubulin Antibody / TUBB1 |
Application: | WB, IF, FC, IHC (paraffin), Direct ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
755.00€
*