Kontakt 0800-2466651 DE | EN Login Warenkorb
Name EXPRIMIERT IN URSPRUNGS-ART FORMAT ANWENDUNG HERSTELLER KAT # MENGE PREIS







159 Treffer
Filter zum Verfeinern Ihrer Suche:
  E.coli [74]
Human cells [6]
Pichia Pastoris [3]
Yeast [74]
 
human [44]
mouse [21]
rat [20]
rabbit [6]
chicken [2]
guin. pig [2]
bovine [6]
swine [17]
 
    Biomol GmbH [58]
HumanZyme [6]
Kingfisher [74]
Rockland [3]
USBio [18]
 
   


MW: 18.022 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
50430.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.500 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
50441.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.000

Inhibits the activity of IL-​1 by binding to its receptor. Has no IL-​1 like activity. (www.uniprot.org)
E.coli human
Erklärungen der Abkürzungen ansehen.
BioassayErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
54592.20 20 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.416 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87329.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.703 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87380.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 18.076 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli swine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87381.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.000 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell biology studiesErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
94886.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 30.250 D

Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-​1 (ICAM-​1) in fibroblasts. (www.uniprot.org) Produced in E.coli as a homodimeric, non-​glycosylated polypep ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
94896.5 5 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 18.000 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
lyophilized Cell biology studiesErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
95055.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

Induces stromal cells to produce proinflammatory and hematopoietic cytokines (By similarity). (www.uniprot.org) Produced in E.coli as a homodimeric, non-​glycosylated polypeptide chain
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97084.5 5 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.000 D

Human recombinant IL1F5 produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17kDa. Human interleukin family 1, member 5 (IL-​1F5 / FIL1-​delta) belongs to the interleukin 1 cytokine f ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97486.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 18.600 D

Human recombinant IL37 (IL1F7) produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 167 amino acids (Lys53-​Asp218) and having a molecular mass of 18.6kDa. Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97487.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.500 D

Rat recombinant IL-​1RA produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 152 amino acids and having a molecular mass of 17.5kDa. Interleukin-​1 ra is a member of the interleukin 1 cytokine family. This protein inhibits the acti ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97489.5 5 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 19.000 D

Human recombinant IL11 produced in Pichia Pastoris is a single, non-​glycosylated, polypeptide chain containing 177 amino acids (it differs from the 178 amino acid length of the native IL11 only in lack of the N-​terminal proline residue) and having a molec ... mehr
Pichia Pastoris human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97491.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 12.400 D

Human recombinant Interleukin-​16 produced in E.coli is a single, non-​glycosylated polypeptide chain containing 121 amino acids and having a molecular mass of 12.4 kDa. IL-​16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T c ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97495.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.700 D

Human recombinant IL36B produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17.7kDa. Human IL-​36b belongs to the IL-​1 family that includes IL-​1b, IL-​1a, IL-​1ra, IL-​18, IL-​36ra (IL1F ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97513.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 21.000 D

IL36B Mouse recombinant produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 183 amino acids and having a molecular mass of 21.0kDa. Mouse IL-​36b belongs to the IL-​1 family that includes IL-​1b, IL-​1a, IL-​1ra, IL-​18, IL-​36ra (IL1F ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97514.2 2 µg

Buy Bulk

69 €In Warenkorb aufnehmen

MW: 17.400 D

Recombinant horse Interleukin-​1 Receptor Antagonist produced in E.coli cells is a single, non-​glycosylated, polypeptide chain containing 152 amino acids. Interleukin-​1 ra is a member of the interleukin 1 cytokine family. This protein inhibits the activiti ... mehr
E.coli equine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97626.20 20 µg

Buy Bulk

69 €In Warenkorb aufnehmen

Authentic recombinant human protein, human cell expressed, which in general ensures proper folding, phosphorylation, disulfide bridge formation, proteolytic processing, and glycosylation. Endotoxin <1.0 EU/µg.
Human cells human
Erklärungen der Abkürzungen ansehen.
Cell culture
bioassaysErklärungen der Abkürzungen ansehen.
HumanZyme
Icon Datasheet
HZ-​1113

related products
10 µg

Buy Bulk

108 €In Warenkorb aufnehmen

MW: 17,3 kD

Biologically active. Produced in yeast. Amino acid sequence: AAVHSVNCRL RDIYHKSLVL SGACELQAVH LNGENTNQQV VFCMSFVQGE EETDKIPVAL GLKEKNLYLS CGMKDGKPTL QLETVDPNTY PKRKMEKRFV FNKMEIKGNV EFESAMYPNW YISTSQAEKK PVFLGNTRGG RDITDFIMEI TSA
Yeast equine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0060E-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,5 kD

Biologically active. Produced in yeast. Amino acid sequence: AAMQSVDCKL QDISHKYLVL SNSYELRALH LNGENVNKQV VFHMSFVHGD ESNNKIPVVL GIKQKNLYLS CVMKDGKPTL QLEKVDPKVY PKRKMEKRFV FNKIEIKNTV EFESSQYPNW YISTSQVEGM PVFLGNTRGG QDITDFTMEF SS
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0085D-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,1 kD

Produced in yeast. Amino acid sequence: SNVKYNFMRV IHQECILNDA LNQSIIRDMS GPYLTATTLN NLEEAVKFDM VAYVSEEDSQ LPVTLRISKT QLFVSAQNED EPVLLKEMPE TPKIIKDETN LLFFWEKHGS MDYFKSVAHP KLFIATKQEK LVHMASGPPS ITDFQILEK
Yeast bovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0097B-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,4 kD

Biologically active. Produced in yeast. Amino acid sequence: AAIQSQDYTF RDISQKSLVL SGSYELRALH LNGQNMNQQV VFRMSFVHGE ENSKKIPVVL CIKKNNLYLS CVMKDGKPTL QLEMLDPKVY PKKKMEKRFV FNKTEIKGNV EFESSQFPNW YISTSQAEEM PVFLGNTKGG QDITDFIMES AS
Yeast feline
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0098F-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,7 kD

Produced in yeast. Amino acid sequence: APVQSIKCKL QDREQKSLVL ASPCVLKALH LLSQEMNREV VFCMSFVQGE ERDNKIPVAL GIKDKNLYLS CVKKGDTPTL QLEEVDPKVY PKRNMEKRFV FYKTEIKNTV EFESVLYPNW YISTSQIEER PVFLGHFRGG QDITDFRMET LSP
Yeast bovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0106B-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 14,9 kD

Produced in yeast. Amino acid sequence: GIMIPQSPGC PKTEDKNFPQ HVRVNLNILN RSTPARRPSD YSKRSTSPWT LQRNEDPERY PSVIWEAKCS HSGCINAEGK EDHHMNSVPI QQEILVLRRE PRHCPNSFRL EKVMVTVGCT CVTPIVRHIS (130)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0128S-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,9 kD

Produced in yeast. Amino acid sequence: APAFRYTRSQ SFDIFDINQK CFVLESPTQL VALHLQGPSS SQKVRLNIAL YRPRGPRGSA GAGQTPVALG IKGYKLYMSC VLSGAEPTLQ LEEADVTRDI DSAELTRFVF YRLDSPAEGT TRFESAAFPG WFICTSLQPR QPVGITNRPD QVNIATYKLS GR (162)
Yeast turkey
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0134T-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,4 kD

Produced in yeast. Amino acid sequence: AVRSLHCRLQ DAQQKSLVLS GTYELKALHL NAENLNQQVV FSMSFVQGEE SNDKIPVALG LRGKNLYLSC VMKDDKPTLQ LESVDPNRYP KKKMEKRFVF NKIEIKDKLE FESAQFPNWY ISTSQTEYMP VFLGNNSGGQ DLIDFSMEFV SS (152)
Yeast rabbit
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0141U-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 18 kD

Produced in yeast. Amino acid sequence: SVAPNFYSSE KYNYQKIIKS QFILNDNLSQ SVIRKAGGKY LAAAALQNLD DAVKFDMGAY TSKEDSKLPV TLRISKTRLF VSAQNEDEPV LLKEMPETPK TIRDETNLLF FWERHGSKNY FKSVAHPKLF IATQEEQLVH MARGLPSVTD FQILETQS (158)
Yeast feline
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0295F-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,6 kD

Produced in yeast. Amino acid sequence: ANVQSMECKL QDKDHKSLVL AGPHMLKALH LLTGDLKREV VFCMSFVQGD DSNNKIPVTL GIKGKNLYLS CVMKDNTPTL QLEDIDPKRY PKRDMEKRFV FYKTEIKNRV EFESALYPNW YISTSQAEQK PVFLGNSKGR QDITDFTMEV LSP (153)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0297S-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 16,5 kD

Produced in yeast. Amino acid sequence: SNMKYNFIKL IQQQYILNDA LHQSIVLHPS GQHLMAAALN NLDEAVEFDI AAYTSGDDTQ LPVTLRISKT QLFVCAQNEG EPVLLKEMPE TPQTIKDETD LLFLWSNHGS MQHFKSVAHP KLYFATKGEK LVHLARGPPS IIDFQL (146)
Yeast dolphin
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0310P-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,2 kD

Produced in yeast. Amino acid sequence: TPVPSRNCTL HDIQHKRLVL SDPCELKALH LNGDNLNRQV VFSMSFVQGE RSDNKMPVAL GLKGKNLYLS CVMKDGKPVL QLESVDGKQY PKKKMEKRFV FNKITSKSTV EFESAQFPNW YISTSQAEHK PVFLGNNNGQ DIIDFKLELV SS (152)
Yeast guinea pig
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0343GP-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,8 kD

Produced in yeast. Amino acid sequence: SVPYTFQRNM RYKYLRIIKQ EFTLNDALNQ SLVRDTSDQY LRAAPLQNLG DAVKFDMGVY MTSEDSILPV TLRISQTPLF VSAQNEDEPV LLKEMPETPR IITDSESDIL FFWETQGNKN YFKSAANPQL FIATKPEHLV HMARGLPSMT DFQIS (155)
Yeast rabbit
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0346U-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,5 kD

Produced in yeast. Amino acid sequence: AAVQSLTCKL QDRDQKSLVL ASPCVLKALH LLARDMNREV VFCMSFVQGD ESNDKIPVAL GLKEKNLYLS CVMKGDRPIL QLEEVDPKTY PKWKMEKRFV FNKTEIKNSV EFESALYPNW YISTSQAEEK PIFLGRSKGG HDITDFTMEI ISP (153)
Yeast dolphin
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0347P-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,2 kD

Produced in yeast. Amino acid sequence: HPLGKRRCEM QAFRIWDVNQ KIFYLRNNQL VAGYLQGPNT KLEEKIDVVP IEPHTMFLGI HGGKLCLACV KSGDEIKLKL EAVNITDLNQ NREQDKRFAF IRFDNGPTTS FESAACPGWF LCTSLEADQP VGLTNMPTEA LKVTKFYFQQ D (151)
Yeast bovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0351B-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 15 kD

Produced in yeast. Amino acid sequence: AAIIPQSSAC PNTEAKDFLQ NVKVNLKVFN SLGAKVSSRR PSDYLNRSTS PWTLHRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPESCPFT FRVEKMLVGV GCTCVASIVR QAA (133)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0355M-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 18,1 kD

Produced in yeast. Amino acid sequence: SVHYNFQSNT KYNFMRIVNH QCTLNDALNQ SVIRDTSGQY LATAALNNLD DAVKFDMGAY TSEEDSQLPV TLRISKTRLF VSAQNEDEPV LLKEMPDTPK TIKDETNLLF FWERHGSKNY FKSVAHPKLF IATKQGKLVH MARGQPSITD FQILDNQF (158)
Yeast equine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0358E-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,4 kD

Produced in yeast. Amino acid sequence: VPIRQLHYRL RDEQQKSLVL SDPYELKALH LNGQNINQQV IFSMSFVQGE PSNDKIPVAL GLKGKNLYLS CVMKDGTPTL QLESVDPKQY PKKKMEKRFV FNKIEVKSKV EFESAEFPNW YISTSQAEHK PVFLGNNSGQ DIIDFTMESV SS (152)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0359M-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,2 kD

Produced in yeast. Amino acid sequence: HPLGKRPCRM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNT KLEEKIDVVP VEPHFVFLGI HGGKLCLSCV KSGDEMKLQL EPVNITDLRK NSEQDKRFTF IRSDSGPTTS FESAACPGWF LCTALEADQP VGLTNTPKAA VKVTKFYFQQ DQ (152)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0425S-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 16,8 kD

Produced in yeast. Amino acid sequence: LGKRPCRMQA FRIWDVNQKT FYLRNNQLVA GYLQGSNTKL EEKLDVVPVE PHAVFLGIHG GKLCLACVKS GDETRLQLEA VNITDLSKNK DQDKRFTFIL SDSGPTTSFE SAACPGWFLC TALEADRPVS LTNRPEEAMM VTKFYFQKE (149)
Yeast Canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0427D-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,4 kD

Produced in yeast. Amino acid sequence: HPLGKRPCKM QAFRIWDVNQ KTFYMRNNQL VAGYLQESNT KLQEKIDVVP IEPDALFLGL HGRKLCLACV KSGDEIRFQL EAVNITDLSK NKEENKRFTF IRSNSGPTTS FESAACPGWF LCTAQEADRP VSLTNKPKES FMVTKFYLQE DQ (152)
Yeast Equine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0428E-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17 kD

Produced in yeast. Amino acid sequence: YPLGKRPCEM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNT KLEEKIDVVP IEPHAMFLGI HGGKLCLACV KSGDEIKLGL EPVNITDLNS SKEEDKRFAF IRSDSGPTTS FESAACPGWF LCTALETDQP VGLTNTPQDA VQVTKFYFQQ DQ (152)
Yeast dolphin
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0441P-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 14,9 kD

Produced in yeast. Amino acid sequence: GIAMPRNPGC PNAEDKNFPQ NVKVSLNILN KSVNSRRPSD YYNRSTSPWT LHRNEDHERY PSVIWEAKCR HLGCVNAEGN VDHHMNSVPI QQEILVLRRE SQHCPHSFRL EKMLVAVGCT CVTPIIHHMA (130)
Yeast rabbit
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0456U-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 15 kD

Produced in yeast. Amino acid sequence: AVLIPQSSVC PNAEANNFLQ NVKVNLKVLN SLSSKASSRR PSDYLNRSTS PWTLSRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPEKCPFT FRVEKMLVGV GCTCVSSIVR HAS (133)
Yeast rat
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0457R-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,8 kD

Produced in yeast. Amino acid sequence: SVPCRAPALQ TKVFKYRIWD MNQQSLYLRD DQLVAGHLQG ANAALEEKVF WVPNRFFKHE LQPVIMGIRN GTRCLACPAA PQPTLQLQDA DITELPRSGA ASAPFTFFRT YKDGLWRFES AANPGWFLCT SARAHQPLGL SRRPDAAHVL DFYFQLC (157)
Yeast chicken
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0467C-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 18,2 kD

Produced in yeast. Amino acid sequence: SVAYNFHNNE KYNYIRIIKS QFILNDNLNQ SIVRQTGGNY LMTAALQNLD DAVKFDMGAY TSEDSKLPVT LRISKTRLFV SAQNEDEPVL LKEMPETPKT IRDETNLLFF WERHGSKHYF KSVAQPKLFI ATQERKLVHM ARGQPSITDF RLLETQP (157)
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0486D-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 17,7 kD

Produced in yeast. Amino acid sequence: AAVQSVKCKL QDREQKSLVL DSPCVLKALH LLSQEMSREV VFCMSFVQGE ERDNKIPVAL GIRDKNLYLS CVKKGDTPTL QLEEVDPKVY PKRNMEKRFV FYKTEIKNTV EFESVLYPNW YISTSQIEEK PVFLGRFRGG QDITDFRMET LSP (153)
Yeast ovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0656V-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 18 kD

Produced in yeast. Amino acid sequence: SAPYTYQSDL RYKLMKLVRQ KFVMNDSLNQ TIYQDVDKHY LSTTWLNDLQ QEVKFDMYAY SSGGDDSKYP VTLKISDSQL FVSAQGEDQP VLLKELPETP KLITGSETDL IFFWKSINSK NYFTSAAYPE LFIATKEQSR VHLARGLPSM TDFQIS (156)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0905M-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen
neu
MW: 14,8 kD

Produced in Yeast. Amino acid sequence: FPQNPGCRNT EDKNFPQHVK VNLNILNRNT NSRRPSDYYN RSTSPWNLHR NEDPERYPSV IWEAKCRHLG CVNNEGNINY HMNSVPIQQE ILVLRRESQH CPHSFRLEKM LVAVGCTCVT PIVRHVA (127).
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0920D-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen
neu
MW: 15,1 kD

Produced in Yeast. Amino acid sequence: GITIPRNPGC PNSEDKNFPR TVMVNLNIHN RNTNTNPKRS SDYYNRSTSP WNLHRNEDPE RYPSVIWEAK CRHLGCINAD GNVDYHMNSV PIQQEILVLR REPPHCPNSF RLEKILVSVG CTCVTPIVHH VA (132). Protein function: Induces stromal cells to produce proinflamma ... mehr
Yeast human
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0921H-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen
neuIL-​17A, ovine recombinant (rovIL-​17A)
MW: 14,8 kD

Produced in Yeast. Amino acid sequence: GVIIPQSPGC PPTEDKNFPQ HVRVNLNIVN RNTNSRRPTD YHKRSTSPWT LHRNEDPERY PSVIWEAKCS HSGCINAEGK VDHHMNSVTI QQEILVLRRE SQHCPHSFRL EKMLVAVGCT CVTPIVRHVA (130).
Yeast ovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0922V-​005 5 µg

Buy Bulk

125 €In Warenkorb aufnehmen

MW: 18.022 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
50430.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.500 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
50441.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.000

Inhibits the activity of IL-​1 by binding to its receptor. Has no IL-​1 like activity. (www.uniprot.org) Purity: >98%
E.coli human
Erklärungen der Abkürzungen ansehen.
Inflammation response blockingErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
54592.100 100 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.416 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87329.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.703 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87380.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 18.076 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli swine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87381.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.000 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell biology studiesErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
94886.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 30.250 D

Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-​1 (ICAM-​1) in fibroblasts. (www.uniprot.org) Produced in E.coli as a homodimeric, non-​glycosylated polypep ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
94896.25 25 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 18.000 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
lyophilized Cell biology studiesErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
95055.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

Induces stromal cells to produce proinflammatory and hematopoietic cytokines (By similarity). (www.uniprot.org) Produced in E.coli as a homodimeric, non-​glycosylated polypeptide chain
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97084.25 25 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.000 D

Human recombinant IL1F5 produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17kDa. Human interleukin family 1, member 5 (IL-​1F5 / FIL1-​delta) belongs to the interleukin 1 cytokine f ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97486.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 18.600 D

Human recombinant IL37 (IL1F7) produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 167 amino acids (Lys53-​Asp218) and having a molecular mass of 18.6kDa. Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97487.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.500 D

Rat recombinant IL-​1RA produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 152 amino acids and having a molecular mass of 17.5kDa. Interleukin-​1 ra is a member of the interleukin 1 cytokine family. This protein inhibits the acti ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97489.20 20 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 19.000 D

Human recombinant IL11 produced in Pichia Pastoris is a single, non-​glycosylated, polypeptide chain containing 177 amino acids (it differs from the 178 amino acid length of the native IL11 only in lack of the N-​terminal proline residue) and having a molec ... mehr
Pichia Pastoris human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97491.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 12.400 D

Human recombinant Interleukin-​16 produced in E.coli is a single, non-​glycosylated polypeptide chain containing 121 amino acids and having a molecular mass of 12.4 kDa. IL-​16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T c ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97495.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.700 D

Human recombinant IL36B produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17.7kDa. Human IL-​36b belongs to the IL-​1 family that includes IL-​1b, IL-​1a, IL-​1ra, IL-​18, IL-​36ra (IL1F ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97513.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 21.000 D

IL36B Mouse recombinant produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 183 amino acids and having a molecular mass of 21.0kDa. Mouse IL-​36b belongs to the IL-​1 family that includes IL-​1b, IL-​1a, IL-​1ra, IL-​18, IL-​36ra (IL1F ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97514.10 10 µg

Buy Bulk

179 €In Warenkorb aufnehmen

MW: 17.400 D

Recombinant horse Interleukin-​1 Receptor Antagonist produced in E.coli cells is a single, non-​glycosylated, polypeptide chain containing 152 amino acids. Interleukin-​1 ra is a member of the interleukin 1 cytokine family. This protein inhibits the activiti ... mehr
E.coli equine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97626.100 100 µg

Buy Bulk

179 €In Warenkorb aufnehmen

Authentic recombinant human protein, human cell expressed, which in general ensures proper folding, phosphorylation, disulfide bridge formation, proteolytic processing, and glycosylation. Endotoxin <0.1EU/µg.
Human cells human
Erklärungen der Abkürzungen ansehen.
Cell culture
bioassaysErklärungen der Abkürzungen ansehen.
HumanZyme
Icon Datasheet
HZ-​1164

related products
10 µg

Buy Bulk

241 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), rat recombinant (rrIL-​1a)
E.coli rat
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663-​01A2.2 2 µg

Buy Bulk

248 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), human recombinant (rHuIL-​1a)
E.coli human
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663A.2 2 µg

Buy Bulk

248 €In Warenkorb aufnehmen

E.coli swine
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663Q.2 2 µg

Buy Bulk

248 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), human recombinant (rHuIL-​1a), highly purified
Mw: 18.0kD.
E.coli human
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663.2 2 µg

Buy Bulk

259 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), murine recombinant (rmIL-​1a), highly purified
Mw: 17.9kD.
E.coli mouse
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663-​01.2 2 µg

Buy Bulk

259 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), rat recombinant (rrIL-​1a), highly purified
E.coli rat
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663-​01A.2 2 µg

Buy Bulk

259 €In Warenkorb aufnehmen

MW: 15,7 kD

Protein function: Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of ICAM1/intracellular adhesion molecule 1 in fibroblasts. [The UniProt Consortium]
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Control / ImmunoassaysErklärungen der Abkürzungen ansehen. Rockland
Icon Datasheet
009-​001-​B32 25 µg

Buy Bulk

270 €
243 €

save money!
In Warenkorb aufnehmen

MW: 30 kD

Protein function: Induces stromal cells to produce proinflammatory and hematopoietic cytokines. [The UniProt Consortium]
E.coli mouse
Erklärungen der Abkürzungen ansehen.
lyophilized Control / ImmunoassaysErklärungen der Abkürzungen ansehen. Rockland
Icon Datasheet
010-​001-​B32 25 µg

Buy Bulk

270 €
243 €

save money!
In Warenkorb aufnehmen

MW: 30 kD

Protein function: Induces stromal cells to produce proinflammatory and hematopoietic cytokines. [The UniProt Consortium]
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Control / ImmunoassaysErklärungen der Abkürzungen ansehen. Rockland
Icon Datasheet
012-​001-​B32 25 µg

Buy Bulk

270 €
243 €

save money!
In Warenkorb aufnehmen

MW: 17,3 kD

Biologically active. Produced in yeast. Amino acid sequence: AAVHSVNCRL RDIYHKSLVL SGACELQAVH LNGENTNQQV VFCMSFVQGE EETDKIPVAL GLKEKNLYLS CGMKDGKPTL QLETVDPNTY PKRKMEKRFV FNKMEIKGNV EFESAMYPNW YISTSQAEKK PVFLGNTRGG RDITDFIMEI TSA
Yeast equine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0060E-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,5 kD

Biologically active. Produced in yeast. Amino acid sequence: AAMQSVDCKL QDISHKYLVL SNSYELRALH LNGENVNKQV VFHMSFVHGD ESNNKIPVVL GIKQKNLYLS CVMKDGKPTL QLEKVDPKVY PKRKMEKRFV FNKIEIKNTV EFESSQYPNW YISTSQVEGM PVFLGNTRGG QDITDFTMEF SS
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0085D-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,1 kD

Produced in yeast. Amino acid sequence: SNVKYNFMRV IHQECILNDA LNQSIIRDMS GPYLTATTLN NLEEAVKFDM VAYVSEEDSQ LPVTLRISKT QLFVSAQNED EPVLLKEMPE TPKIIKDETN LLFFWEKHGS MDYFKSVAHP KLFIATKQEK LVHMASGPPS ITDFQILEK
Yeast bovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0097B-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,4 kD

Biologically active. Produced in yeast. Amino acid sequence: AAIQSQDYTF RDISQKSLVL SGSYELRALH LNGQNMNQQV VFRMSFVHGE ENSKKIPVVL CIKKNNLYLS CVMKDGKPTL QLEMLDPKVY PKKKMEKRFV FNKTEIKGNV EFESSQFPNW YISTSQAEEM PVFLGNTKGG QDITDFIMES AS
Yeast feline
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0098F-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,7 kD

Produced in yeast. APVQSIKCKL QDREQKSLVL ASPCVLKALH LLSQEMNREV VFCMSFVQGE ERDNKIPVAL GIKDKNLYLS CVKKGDTPTL QLEEVDPKVY PKRNMEKRFV FYKTEIKNTV EFESVLYPNW YISTSQIEER PVFLGHFRGG QDITDFRMET LSP
Yeast bovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0106B-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 14,9 kD

Produced in yeast. Amino acid sequence: GIMIPQSPGC PKTEDKNFPQ HVRVNLNILN RSTPARRPSD YSKRSTSPWT LQRNEDPERY PSVIWEAKCS HSGCINAEGK EDHHMNSVPI QQEILVLRRE PRHCPNSFRL EKVMVTVGCT CVTPIVRHIS (130)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0128S-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,9 kD

Produced in yeast. Amino acid sequence: APAFRYTRSQ SFDIFDINQK CFVLESPTQL VALHLQGPSS SQKVRLNIAL YRPRGPRGSA GAGQTPVALG IKGYKLYMSC VLSGAEPTLQ LEEADVTRDI DSAELTRFVF YRLDSPAEGT TRFESAAFPG WFICTSLQPR QPVGITNRPD QVNIATYKLS GR (162)
Yeast turkey
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0134T-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,4 kD

Produced in yeast. Amino acid sequence: AVRSLHCRLQ DAQQKSLVLS GTYELKALHL NAENLNQQVV FSMSFVQGEE SNDKIPVALG LRGKNLYLSC VMKDDKPTLQ LESVDPNRYP KKKMEKRFVF NKIEIKDKLE FESAQFPNWY ISTSQTEYMP VFLGNNSGGQ DLIDFSMEFV SS (152)
Yeast rabbit
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0141U-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 18 kD

Produced in yeast. Amino acid sequence: SVAPNFYSSE KYNYQKIIKS QFILNDNLSQ SVIRKAGGKY LAAAALQNLD DAVKFDMGAY TSKEDSKLPV TLRISKTRLF VSAQNEDEPV LLKEMPETPK TIRDETNLLF FWERHGSKNY FKSVAHPKLF IATQEEQLVH MARGLPSVTD FQILETQS (158)
Yeast feline
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0295F-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,6 kD

Produced in yeast. Amino acid sequence: ANVQSMECKL QDKDHKSLVL AGPHMLKALH LLTGDLKREV VFCMSFVQGD DSNNKIPVTL GIKGKNLYLS CVMKDNTPTL QLEDIDPKRY PKRDMEKRFV FYKTEIKNRV EFESALYPNW YISTSQAEQK PVFLGNSKGR QDITDFTMEV LSP (153)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0297S-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 16,5 kD

Produced in yeast. Amino acid sequence: SNMKYNFIKL IQQQYILNDA LHQSIVLHPS GQHLMAAALN NLDEAVEFDI AAYTSGDDTQ LPVTLRISKT QLFVCAQNEG EPVLLKEMPE TPQTIKDETD LLFLWSNHGS MQHFKSVAHP KLYFATKGEK LVHLARGPPS IIDFQL (146)
Yeast dolphin
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0310P-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,2 kD

Produced in yeast. Amino acid sequence: TPVPSRNCTL HDIQHKRLVL SDPCELKALH LNGDNLNRQV VFSMSFVQGE RSDNKMPVAL GLKGKNLYLS CVMKDGKPVL QLESVDGKQY PKKKMEKRFV FNKITSKSTV EFESAQFPNW YISTSQAEHK PVFLGNNNGQ DIIDFKLELV SS (152)
Yeast guinea pig
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0343GP-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,8 kD

Produced in yeast. Amino acid sequence: SVPYTFQRNM RYKYLRIIKQ EFTLNDALNQ SLVRDTSDQY LRAAPLQNLG DAVKFDMGVY MTSEDSILPV TLRISQTPLF VSAQNEDEPV LLKEMPETPR IITDSESDIL FFWETQGNKN YFKSAANPQL FIATKPEHLV HMARGLPSMT DFQIS (155)
Yeast rabbit
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0346U-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,5 kD

Produced in yeast. Amino acid sequence: AAVQSLTCKL QDRDQKSLVL ASPCVLKALH LLARDMNREV VFCMSFVQGD ESNDKIPVAL GLKEKNLYLS CVMKGDRPIL QLEEVDPKTY PKWKMEKRFV FNKTEIKNSV EFESALYPNW YISTSQAEEK PIFLGRSKGG HDITDFTMEI ISP (153)
Yeast dolphin
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0347P-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,2 kD

Produced in yeast. Amino acid sequence: HPLGKRRCEM QAFRIWDVNQ KIFYLRNNQL VAGYLQGPNT KLEEKIDVVP IEPHTMFLGI HGGKLCLACV KSGDEIKLKL EAVNITDLNQ NREQDKRFAF IRFDNGPTTS FESAACPGWF LCTSLEADQP VGLTNMPTEA LKVTKFYFQQ D (151)
Yeast bovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0351B-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 15 kD

Produced in yeast. Amino acid sequence: AAIIPQSSAC PNTEAKDFLQ NVKVNLKVFN SLGAKVSSRR PSDYLNRSTS PWTLHRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPESCPFT FRVEKMLVGV GCTCVASIVR QAA (133)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0355M-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 18,1 kD

Produced in yeast. Amino acid sequence: SVHYNFQSNT KYNFMRIVNH QCTLNDALNQ SVIRDTSGQY LATAALNNLD DAVKFDMGAY TSEEDSQLPV TLRISKTRLF VSAQNEDEPV LLKEMPDTPK TIKDETNLLF FWERHGSKNY FKSVAHPKLF IATKQGKLVH MARGQPSITD FQILDNQF (158)
Yeast equine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0358E-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,4 kD

Produced in yeast. Amino acid sequence: VPIRQLHYRL RDEQQKSLVL SDPYELKALH LNGQNINQQV IFSMSFVQGE PSNDKIPVAL GLKGKNLYLS CVMKDGTPTL QLESVDPKQY PKKKMEKRFV FNKIEVKSKV EFESAEFPNW YISTSQAEHK PVFLGNNSGQ DIIDFTMESV SS (152)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0359M-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,2 kD

Produced in yeast. Amino acid sequence: HPLGKRPCRM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNT KLEEKIDVVP VEPHFVFLGI HGGKLCLSCV KSGDEMKLQL EPVNITDLRK NSEQDKRFTF IRSDSGPTTS FESAACPGWF LCTALEADQP VGLTNTPKAA VKVTKFYFQQ DQ (152)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0425S-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 16,8 kD

Produced in yeast. Amino acid sequence: LGKRPCRMQA FRIWDVNQKT FYLRNNQLVA GYLQGSNTKL EEKLDVVPVE PHAVFLGIHG GKLCLACVKS GDETRLQLEA VNITDLSKNK DQDKRFTFIL SDSGPTTSFE SAACPGWFLC TALEADRPVS LTNRPEEAMM VTKFYFQKE (149)
Yeast Canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0427D-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,4 kD

Produced in yeast. Amino acid sequence: HPLGKRPCKM QAFRIWDVNQ KTFYMRNNQL VAGYLQESNT KLQEKIDVVP IEPDALFLGL HGRKLCLACV KSGDEIRFQL EAVNITDLSK NKEENKRFTF IRSNSGPTTS FESAACPGWF LCTAQEADRP VSLTNKPKES FMVTKFYLQE DQ (152)
Yeast Equine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0428E-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17 kD

Produced in yeast. Amino acid sequence: YPLGKRPCEM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNT KLEEKIDVVP IEPHAMFLGI HGGKLCLACV KSGDEIKLGL EPVNITDLNS SKEEDKRFAF IRSDSGPTTS FESAACPGWF LCTALETDQP VGLTNTPQDA VQVTKFYFQQ DQ (152)
Yeast dolphin
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0441P-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 14,9 kD

Produced in yeast. Amino acid sequence: GIAMPRNPGC PNAEDKNFPQ NVKVSLNILN KSVNSRRPSD YYNRSTSPWT LHRNEDHERY PSVIWEAKCR HLGCVNAEGN VDHHMNSVPI QQEILVLRRE SQHCPHSFRL EKMLVAVGCT CVTPIIHHMA (130)
Yeast rabbit
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0456U-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 15 kD

Produced in yeast. Amino acid sequence: AVLIPQSSVC PNAEANNFLQ NVKVNLKVLN SLSSKASSRR PSDYLNRSTS PWTLSRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPEKCPFT FRVEKMLVGV GCTCVSSIVR HAS (133)
Yeast rat
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0457R-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,8 kD

Produced in yeast. Amino acid sequence: SVPCRAPALQ TKVFKYRIWD MNQQSLYLRD DQLVAGHLQG ANAALEEKVF WVPNRFFKHE LQPVIMGIRN GTRCLACPAA PQPTLQLQDA DITELPRSGA ASAPFTFFRT YKDGLWRFES AANPGWFLCT SARAHQPLGL SRRPDAAHVL DFYFQLC (157)
Yeast chicken
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0467C-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 18,2 kD

Produced in yeast. Amino acid sequence: SVAYNFHNNE KYNYIRIIKS QFILNDNLNQ SIVRQTGGNY LMTAALQNLD DAVKFDMGAY TSEDSKLPVT LRISKTRLFV SAQNEDEPVL LKEMPETPKT IRDETNLLFF WERHGSKHYF KSVAQPKLFI ATQERKLVHM ARGQPSITDF RLLETQP (157)
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0486D-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 17,7 kD

Produced in yeast. Amino acid sequence: AAVQSVKCKL QDREQKSLVL DSPCVLKALH LLSQEMSREV VFCMSFVQGE ERDNKIPVAL GIRDKNLYLS CVKKGDTPTL QLEEVDPKVY PKRNMEKRFV FYKTEIKNTV EFESVLYPNW YISTSQIEEK PVFLGRFRGG QDITDFRMET LSP (153)
Yeast ovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0656V-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen

MW: 18 kD

Produced in yeast. Amino acid sequence: SAPYTYQSDL RYKLMKLVRQ KFVMNDSLNQ TIYQDVDKHY LSTTWLNDLQ QEVKFDMYAY SSGGDDSKYP VTLKISDSQL FVSAQGEDQP VLLKELPETP KLITGSETDL IFFWKSINSK NYFTSAAYPE LFIATKEQSR VHLARGLPSM TDFQIS (156)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0905M-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen
neu
MW: 14,8 kD

Produced in Yeast. Amino acid sequence: FPQNPGCRNT EDKNFPQHVK VNLNILNRNT NSRRPSDYYN RSTSPWNLHR NEDPERYPSV IWEAKCRHLG CVNNEGNINY HMNSVPIQQE ILVLRRESQH CPHSFRLEKM LVAVGCTCVT PIVRHVA (127).
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0920D-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen
neu
MW: 15,1 kD

Produced in Yeast. Amino acid sequence: GITIPRNPGC PNSEDKNFPR TVMVNLNIHN RNTNTNPKRS SDYYNRSTSP WNLHRNEDPE RYPSVIWEAK CRHLGCINAD GNVDYHMNSV PIQQEILVLR REPPHCPNSF RLEKILVSVG CTCVTPIVHH VA (132). Protein function: Induces stromal cells to produce proinflamma ... mehr
Yeast human
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0921H-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen
neuIL-​17A, ovine recombinant (rovIL-​17A)
MW: 14,8 kD

Produced in Yeast. Amino acid sequence: GVIIPQSPGC PPTEDKNFPQ HVRVNLNIVN RNTNSRRPTD YHKRSTSPWT LHRNEDPERY PSVIWEAKCS HSGCINAEGK VDHHMNSVTI QQEILVLRRE SQHCPHSFRL EKMLVAVGCT CVTPIVRHVA (130).
Yeast ovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0922V-​025 25 µg

Buy Bulk

299 €In Warenkorb aufnehmen
Interleukin-​1 Receptor Antagonist (IL-​1RA), human recombinant (rHuIL-​1RA)
E.coli human
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663-​25N3.50 50 µg

Buy Bulk

310 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), human recombinant (rHuIL-​1a), highly purified
Mw: 18.0kD.
E.coli human
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663.10 10 µg

Buy Bulk

332 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), murine recombinant (rmIL-​1a), highly purified
Mw: 17.9kD.
E.coli mouse
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663-​01.10 10 µg

Buy Bulk

332 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), rat recombinant (rrIL-​1a), highly purified
E.coli rat
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663-​01A.10 10 µg

Buy Bulk

332 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), rat recombinant (rrIL-​1a)
E.coli rat
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663-​01A2.10 10 µg

Buy Bulk

333 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), human recombinant (rHuIL-​1a)
E.coli human
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663A.10 10 µg

Buy Bulk

333 €In Warenkorb aufnehmen

E.coli swine
Erklärungen der Abkürzungen ansehen.
highly purified USBio
Icon Datasheet
I7663Q.10 10 µg

Buy Bulk

333 €In Warenkorb aufnehmen
Interleukin-​1 alpha (IL-​1a), human recombinant (rHuIL-​1a)
E.coli human
Erklärungen der Abkürzungen ansehen.
highly purified ELISAErklärungen der Abkürzungen ansehen. USBio
Icon Datasheet
I7663-​01A4.10 10 µg

Buy Bulk

353 €In Warenkorb aufnehmen
Interleukin-​Receptor 1RA (IL-​1RA), human recombinant (rHuIL-​1RA)
E.coli human
Erklärungen der Abkürzungen ansehen.
highly purified ELISAErklärungen der Abkürzungen ansehen. USBio
Icon Datasheet
I7663-​62A.10 10 µg

Buy Bulk

360 €In Warenkorb aufnehmen

highly purified USBio
Icon Datasheet
I7663-​03N.10 10 µg

Buy Bulk

403 €In Warenkorb aufnehmen
Interleukin-​1alpha (IL-​1a), rat recombinant (rrIL-​1a)
E.coli rat
Erklärungen der Abkürzungen ansehen.
molecular biology grade USBio
Icon Datasheet
I7663-​01A1.10 10 µg

Buy Bulk

516 €In Warenkorb aufnehmen

Authentic recombinant human protein, human cell expressed, which in general ensures proper folding, phosphorylation, disulfide bridge formation, proteolytic processing, and glycosylation. Endotoxin <1.0 EU/µg.
Human cells human
Erklärungen der Abkürzungen ansehen.
Cell culture
bioassaysErklärungen der Abkürzungen ansehen.
HumanZyme
Icon Datasheet
HZ-​1132

related products
100 µg

Buy Bulk

850 €In Warenkorb aufnehmen

MW: 17,5 kD

Biologically active. Produced in yeast. Amino acid sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0085D-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 14,9 kD

Produced in yeast. Amino acid sequence: GIMIPQSPGC PKTEDKNFPQ HVRVNLNILN RSTPARRPSD YSKRSTSPWT LQRNEDPERY PSVIWEAKCS HSGCINAEGK EDHHMNSVPI QQEILVLRRE PRHCPNSFRL EKVMVTVGCT CVTPIVRHIS (130)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0128S-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 15 kD

Produced in yeast. Amino acid sequence: AAIIPQSSAC PNTEAKDFLQ NVKVNLKVFN SLGAKVSSRR PSDYLNRSTS PWTLHRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPESCPFT FRVEKMLVGV GCTCVASIVR QAA (133)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0355M-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 18,1 kD

Produced in yeast. Amino acid sequence: SVHYNFQSNT KYNFMRIVNH QCTLNDALNQ SVIRDTSGQY LATAALNNLD DAVKFDMGAY TSEEDSQLPV TLRISKTRLF VSAQNEDEPV LLKEMPDTPK TIKDETNLLF FWERHGSKNY FKSVAHPKLF IATKQGKLVH MARGQPSITD FQILDNQF (158)
Yeast equine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0358E-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 17,4 kD

Produced in yeast. Amino acid sequence: VPIRQLHYRL RDEQQKSLVL SDPYELKALH LNGQNINQQV IFSMSFVQGE PSNDKIPVAL GLKGKNLYLS CVMKDGTPTL QLESVDPKQY PKKKMEKRFV FNKIEVKSKV EFESAEFPNW YISTSQAEHK PVFLGNNSGQ DIIDFTMESV SS (152)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0359M-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 17,2 kD

Produced in yeast. Amino acid sequence: HPLGKRPCRM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNT KLEEKIDVVP VEPHFVFLGI HGGKLCLSCV KSGDEMKLQL EPVNITDLRK NSEQDKRFTF IRSDSGPTTS FESAACPGWF LCTALEADQP VGLTNTPKAA VKVTKFYFQQ DQ (152)
Yeast swine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0425S-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 16,8 kD

Produced in yeast. Amino acid sequence: LGKRPCRMQA FRIWDVNQKT FYLRNNQLVA GYLQGSNTKL EEKLDVVPVE PHAVFLGIHG GKLCLACVKS GDETRLQLEA VNITDLSKNK DQDKRFTFIL SDSGPTTSFE SAACPGWFLC TALEADRPVS LTNRPEEAMM VTKFYFQKE (149)
Yeast Canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0427D-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 18,2 kD

Produced in yeast. Amino acid sequence: SVAYNFHNNE KYNYIRIIKS QFILNDNLNQ SIVRQTGGNY LMTAALQNLD DAVKFDMGAY TSEDSKLPVT LRISKTRLFV SAQNEDEPVL LKEMPETPKT IRDETNLLFF WERHGSKHYF KSVAQPKLFI ATQERKLVHM ARGQPSITDF RLLETQP (157)
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0486D-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen

MW: 18 kD

Produced in yeast. Amino acid sequence: SAPYTYQSDL RYKLMKLVRQ KFVMNDSLNQ TIYQDVDKHY LSTTWLNDLQ QEVKFDMYAY SSGGDDSKYP VTLKISDSQL FVSAQGEDQP VLLKELPETP KLITGSETDL IFFWKSINSK NYFTSAAYPE LFIATKEQSR VHLARGLPSM TDFQIS (156)
Yeast mouse
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0905M-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen
neu
MW: 14,8 kD

Produced in Yeast. Amino acid sequence: FPQNPGCRNT EDKNFPQHVK VNLNILNRNT NSRRPSDYYN RSTSPWNLHR NEDPERYPSV IWEAKCRHLG CVNNEGNINY HMNSVPIQQE ILVLRRESQH CPHSFRLEKM LVAVGCTCVT PIVRHVA (127).
Yeast canine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0920D-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen
neu
MW: 15,1 kD

Produced in Yeast. Amino acid sequence: GITIPRNPGC PNSEDKNFPR TVMVNLNIHN RNTNTNPKRS SDYYNRSTSP WNLHRNEDPE RYPSVIWEAK CRHLGCINAD GNVDYHMNSV PIQQEILVLR REPPHCPNSF RLEKILVSVG CTCVTPIVHH VA (132). Protein function: Induces stromal cells to produce proinflamma ... mehr
Yeast human
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0921H-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen
neuIL-​17A, ovine recombinant (rovIL-​17A)
MW: 14,8 kD

Produced in Yeast. Amino acid sequence: GVIIPQSPGC PPTEDKNFPQ HVRVNLNIVN RNTNSRRPTD YHKRSTSPWT LHRNEDPERY PSVIWEAKCS HSGCINAEGK VDHHMNSVTI QQEILVLRRE SQHCPHSFRL EKMLVAVGCT CVTPIVRHVA (130).
Yeast ovine
Erklärungen der Abkürzungen ansehen.
lyophilized BioassaysErklärungen der Abkürzungen ansehen. Kingfisher
Icon Datasheet
RP0922V-​100 100 µg

Buy Bulk

897 €In Warenkorb aufnehmen
Interleukin 1 alpha, Recombinant, Mouse (Interleukin-​1 alpha, IL-​1 alpha, IL-​1a, IL1A)
highly purified USBio
Icon Datasheet
I7663-​03N.50 50 µg

Buy Bulk

1002 €In Warenkorb aufnehmen

Authentic recombinant human protein, human cell expressed, which in general ensures proper folding, phosphorylation, disulfide bridge formation, proteolytic processing, and glycosylation. Endotoxin <0.1EU/µg.
Human cells human
Erklärungen der Abkürzungen ansehen.
Cell culture
bioassaysErklärungen der Abkürzungen ansehen.
HumanZyme
Icon Datasheet
HZ-​1165

related products
100 µg

Buy Bulk

1246 €In Warenkorb aufnehmen

Authentic recombinant human protein, human cell expressed, which in general ensures proper folding, phosphorylation, disulfide bridge formation, proteolytic processing, and glycosylation. Endotoxin <1.0 EU/µg.
Human cells human
Erklärungen der Abkürzungen ansehen.
Cell culture
bioassaysErklärungen der Abkürzungen ansehen.
HumanZyme
Icon Datasheet
HZ-​1133

related products
1000 µg

Buy Bulk

4079 €In Warenkorb aufnehmen

Authentic recombinant human protein, human cell expressed, which in general ensures proper folding, phosphorylation, disulfide bridge formation, proteolytic processing, and glycosylation. Endotoxin <0.1EU/µg.
Human cells human
Erklärungen der Abkürzungen ansehen.
Cell culture
bioassaysErklärungen der Abkürzungen ansehen.
HumanZyme
Icon Datasheet
HZ-​1166

related products
1000 µg

Buy Bulk

4816 €In Warenkorb aufnehmen

MW: 18.022 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
50430.1 1 mg anfragen

MW: 17.500 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
50441.1 1 mg anfragen

MW: 17.000

Inhibits the activity of IL-​1 by binding to its receptor. Has no IL-​1 like activity. (www.uniprot.org) Purity: >98%
E.coli human
Erklärungen der Abkürzungen ansehen.
Inflammation response blockingErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
54592.1000 1 mg anfragen

MW: 17.416 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87329.1 1 mg anfragen

MW: 17.690 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli swine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87330.1 1 mg anfragen

MW: 17.690 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli swine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87330.10 10 µg anfragen

MW: 17.690 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli swine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87330.100 100 µg anfragen

MW: 17.690 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli swine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87330.2 2 µg anfragen

MW: 17.703 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87380.1 1 mg anfragen

MW: 18.076 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli swine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
87381.1 1 mg anfragen

MW: 17.000 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell biology studiesErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
94886.1 1 mg anfragen

MW: 30.250 D

Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-​1 (ICAM-​1) in fibroblasts. (www.uniprot.org) Produced in E.coli as a homodimeric, non-​glycosylated polypep ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
94896.1 1 mg anfragen

MW: 18.000 D

Produced by activated macrophages, IL-​1 stimulates thymocyte proliferation by inducing IL-​2 release, B-​cell maturation and proliferation, and fibroblast growth factor activity. IL-​1 proteins are involved in the inflammatory response, being identified as e ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
lyophilized Cell biology studiesErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
95055.1 1 mg anfragen

Induces stromal cells to produce proinflammatory and hematopoietic cytokines (By similarity). (www.uniprot.org) Produced in E.coli as a homodimeric, non-​glycosylated polypeptide chain
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97084.1 1 mg anfragen

MW: 17.000 D

Human recombinant IL1F5 produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17kDa. Human interleukin family 1, member 5 (IL-​1F5 / FIL1-​delta) belongs to the interleukin 1 cytokine f ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97486.1 1 mg anfragen

MW: 18.600 D

Human recombinant IL37 (IL1F7) produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 167 amino acids (Lys53-​Asp218) and having a molecular mass of 18.6kDa. Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97487.1 1 mg anfragen

MW: 17.500 D

Rat recombinant IL-​1RA produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 152 amino acids and having a molecular mass of 17.5kDa. Interleukin-​1 ra is a member of the interleukin 1 cytokine family. This protein inhibits the acti ... mehr
E.coli rat
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97489.1 1 mg anfragen

MW: 19.000 D

Human recombinant IL11 produced in Pichia Pastoris is a single, non-​glycosylated, polypeptide chain containing 177 amino acids (it differs from the 178 amino acid length of the native IL11 only in lack of the N-​terminal proline residue) and having a molec ... mehr
Pichia Pastoris human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97491.1 1 mg anfragen

MW: 12.400 D

Human recombinant Interleukin-​16 produced in E.coli is a single, non-​glycosylated polypeptide chain containing 121 amino acids and having a molecular mass of 12.4 kDa. IL-​16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T c ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97495.1 1 mg anfragen

MW: 17.700 D

Human recombinant IL36B produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17.7kDa. Human IL-​36b belongs to the IL-​1 family that includes IL-​1b, IL-​1a, IL-​1ra, IL-​18, IL-​36ra (IL1F ... mehr
E.coli human
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97513.1 1 mg anfragen

MW: 21.000 D

IL36B Mouse recombinant produced in E.coli is a single, non-​glycosylated, polypeptide chain containing 183 amino acids and having a molecular mass of 21.0kDa. Mouse IL-​36b belongs to the IL-​1 family that includes IL-​1b, IL-​1a, IL-​1ra, IL-​18, IL-​36ra (IL1F ... mehr
E.coli mouse
Erklärungen der Abkürzungen ansehen.
lyophilized Cell CultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97514.1 1 mg anfragen

MW: 17.400 D

Recombinant horse Interleukin-​1 Receptor Antagonist produced in E.coli cells is a single, non-​glycosylated, polypeptide chain containing 152 amino acids. Interleukin-​1 ra is a member of the interleukin 1 cytokine family. This protein inhibits the activiti ... mehr
E.coli equine
Erklärungen der Abkürzungen ansehen.
lyophilized Cell cultureErklärungen der Abkürzungen ansehen. Biomol GmbH
Icon Datasheet
97626.1 1 mg anfragen


  • DatenblattDatenblatt
  • ManualManual
  • neuneu
  • Passende, verwandte ProduktePassende, verwandte Produkte



HOT LINKS


Produkttypen

 

 

Produkte

Service

Company

€ 10

Gutschein sichern