- Search results for 5676-1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
6 products were found matching "5676-1"!
Close filters
Filter by:
No results were found for the filter!
Item number: E-AB-65676.120
The protein encoded by this gene is produced by macrophages and has antiviral activity. This gene is intronless and the encoded protein is secreted. Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an...
Keywords: | Anti-IFNA1, Anti-LeIF D, Anti-IFNA13, Anti-IFN-alpha-1/13, Anti-Interferon alpha-D, Anti-Interferon alpha-1/13, IFNA1... |
Application: | IF |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 198.00€
*
Item number: LKT-E6398.1
EPZ-5676 is an inhibitor of DOT1L histone methyltransferase (HMT) that exhibits anticancer chemotherapeutic activity. In acute myelogenous leukemia (AML) cells with MLL gene translocations, EPZ-5676 displays cytotoxicity, in similar animal models, this compound induces tumor regression without toxicity.
Application: | DOT1L inhibitor |
CAS | 1380288-87-8 |
MW: | 562.71 D |
From 229.00€
*
Item number: VHPS-5676
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | MAGP, MFAP2, MAGP1, MAGP-1, MFAP-2, Microfibrillar-associated protein 2, Microfibril-associated glycoprotein 1 |
Application: | RNA quantification |
43.00€
*
Item number: ELK-ES5676.100
This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and...
Keywords: | Anti-phospho-CYK4, Anti-phospho-HsCYK-4, Anti-phospho-MgcRacGAP, Anti-phospho-Protein CYK4 homolog, Anti-phospho-Male germ... |
Application: | WB, IHC, IF, ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse, rat, monkey |
From 169.00€
*
Item number: 125676.100
Applications:, Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLKKRAAFTKLRRAAILRRERQQKAPRHPLADI, Storage and Stability: May be stored at 4°C for...
Application: | ELISA |
Host: | Mouse |
Species reactivity: | human |
699.00€
*
Item number: 135676.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQS*, Storage and Stability: May...
Application: | ELISA, WB |
Host: | Mouse |
Species reactivity: | human |
699.00€
*