35 products were found matching "E100-104"!
No results were found for the filter!
ACC, FLAG-Tag (Candida albicans)
Item number: BPS-100104
Candida albicans ACC, also known as Acetyl-CoA carboxylase, GenBank Accession No. XM_713531, amino acids 1-2271 (end) with C-terminal FLAG-tag, expressed in Baculovirus infected Sf9 cell expression system. MW = 255 kDa
| Keywords: | Candida albicans ACC, Acetyl-CoA Carboxylase, |
| Application: | Metabolic enzymes |
| Expressed in: | insect cells |
| Origin: | Candida albicans |
| MW: | 255 kD |
759.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNC041104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF405S conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNUB1104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), 0.2mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 321.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNC681104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF568 conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNC941104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF594 conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNC401104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF640R conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNC471104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF647 conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNC881104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF488A conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Anti-PAX2 (Renal Cell & Ovarian Carcinoma Marker)...
Item number: BOT-BNCB1104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
| Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), Biotin conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.) |
From 274.00€
*
GPR81, Control Peptide (Hydroxycarboxylic Acid Receptor...
Item number: 147108.100
Control Peptide for 149876. Source: Synthetic peptide corresponding to 14aa from near the internal region of GPR81. Applications: Suitable for use in ELISA and Antibody Blocking. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be...
| Application: | ELISA |
568.00€
*
Lymphocyte Antigen 6 Complex Locus Protein G6d,...
Item number: 405978.100
Source:, Recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS,...
| Keywords: | LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1... |
| MW: | 15,5 |
From 511.00€
*
Anti-SCYL2 (SCY1-like Protein 2, Coated...
Item number: 133049.100
Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
744.00€
*