- Search results for E100-104
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
35 products were found matching "E100-104"!
Close filters
Filter by:
No results were found for the filter!
Item number: BPS-100104
Candida albicans ACC, also known as Acetyl-CoA carboxylase, GenBank Accession No. XM_713531, amino acids 1-2271 (end) with C-terminal FLAG-tag, expressed in Baculovirus infected Sf9 cell expression system. MW = 255 kDa
Keywords: | Candida albicans ACC, Acetyl-CoA Carboxylase, |
Application: | Metabolic enzymes |
Expressed in: | insect cells |
Origin: | Candida albicans |
MW: | 255 kD |
759.00€
*
Item number: BOT-BNC041104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF405S conjugate, 0.1mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Item number: BOT-BNUB1104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), 0.2mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 321.00€
*
Item number: BOT-BNC681104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF568 conjugate, 0.1mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Item number: BOT-BNC941104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF594 conjugate, 0.1mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Item number: BOT-BNC401104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF640R conjugate, 0.1mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Item number: BOT-BNC471104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF647 conjugate, 0.1mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Item number: BOT-BNC881104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF488A conjugate, 0.1mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Item number: BOT-BNCB1104-100
This antibody recognizes a protein of 42 kDa, which is identified as PAX2. It is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and Müllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region,...
Keywords: | PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), Biotin conjugate, 0.1mg/mL, |
Application: | IHC (paraffin) (verif.) |
From 274.00€
*
Item number: 147108.100
Control Peptide for 149876. Source: Synthetic peptide corresponding to 14aa from near the internal region of GPR81. Applications: Suitable for use in ELISA and Antibody Blocking. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be...
Application: | ELISA |
568.00€
*
Item number: 405978.100
Source:, Recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS,...
Keywords: | LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1... |
MW: | 15,5 |
From 511.00€
*
Item number: 133049.100
Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
Application: | WB |
Host: | Rabbit |
Species reactivity: | human |
744.00€
*