Interleukin-22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF), rat recombinant (rrIL

Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. It belongs to the IL-10-related cytokine family that consists of six members (IL-10, IL-19, IL-20, IL-22, IL-24/MDA-7 and IL-26/AK155). These proteins share structural homology and some degree of amino acid sequence homology to IL-10. Receptors for these proteins are members of the class II cytokine receptor family. The rat IL-22 coding region corresponding to amino acids 48-179 was deduced from a rat genomic clone (Genbank accession #AC111483). The N-terminal portion was cloned from rat adipocyte first strands using degenerate forward primers based on the human and mouse IL-22 amino acid sequences in two independent PCR reactions. Rat IL-22 cDNA predicts a 179aa residue precursor protein with a putative 33aa signal peptide that is cleaved to generate a 147aa mature protein, which shares ~92% and 79% aa sequence identity with mouse and human IL-22, respectively. IL-22 signals through a heterodimeric receptor complex composed of the IL-22R (CRF2-9) subunit and the b chain of IL-10R. In addition, IL-22 also binds to a secreted member of the class II cytokine receptor family called IL-22BP that acts as a natural IL-22 antagonist. IL-22 upregulates acute-phase reactants in the liver and hepatoma cells. In a rat hepatoma cell line, IL-22 has been shown to activate the Jak/STAT and MAPK signaling pathways. Source: A DNA sequence encoding the putative mature rat Interleukin 22 protein sequence expressed in E. coli. Amino Acid Sequence: MLPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLR NACV, Molecular Mass: The methionyl form of recombinant rat IL-22 has a predicted molecular mass of ~16.7kD. Activity: Measured by its ability to induce IL-10 secretion in Colo205 cells. The ED50 is typically 150-750pg/ml., Form: Lyophilized from a 0.2um filtered solution in PBS containing 50ug of BSA/1ug of cytokine. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS, 0.1% HSA or BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.