Interferon alpha 2 (alpha 2b), Recombinant, Human (Interferon alpha-2, IFN-alpha-2, IFNa2, IFNa2b, I

Recombinant protein corresponding to 166aa of human Interferon-alpha 2b expressed in E. coli is a single, non-glycosylated, polypeptide chain. Biological Activity: The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 2.6x10e8 IU/mg. Protein Content: Protein quantitation was carried out by two independent methods: 1. UV spectroscopy at 280nm using the absorbency value of 0.924 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of Recombinant corresponding to Interferon-alpha 2b as a Reference Standard. Amino Acid Sequence: MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE, Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.