- Search results for Cay10353-25
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "Cay10353-25"!
Close filters
Filter by:
No results were found for the filter!
Item number: Cay13532-5
17-phenyl trinor PGE2 ethyl amide is derived from 17-phenyl trinor PGE2, a synthetic analog of PGE2 that acts as an agonist of EP1 and EP3 receptors in mice (Ki = 14 and 3.7 nM, respectively) and EP1, EP3, and EP4 in rats (Ki = 25, 4.3, and 54 nM, respectively). 17-phenyl trinor PGE2 causes contraction of guinea pig...
Keywords: | 17-phenyl trinor PGE2 ethyl amide, N-ethyl-9-oxo-11alpha,15S-dihydroxy-17-phenyl-18,19,20-trinor-prosta-5Z,13E-dien-1-amide |
Application: | EP1/EP3 agonist |
CAS | 1219032-20-8 |
MW: | 413.6 D |
From 126.00€
*
Item number: Cay35325-10
CAY10789 is an antagonist of the cysteinyl leukotriene 1 (CysLT1) receptor (IC50 = 2.1 µM).Formal Name: 3-(2-quinolinylmethoxy)-benzenemethanol. CAS Number: 123226-28-8. Synonyms: [3-(Quinolin-2-ylmethoxy)phenyl]methanol. Molecular Formula: C17H15NO2. Formula Weight: 265.3. Purity: >98%. Formulation: (Request...
Keywords: | [3-(Quinolin-2-ylmethoxy)phenyl]methanol, 3-(2-quinolinylmethoxy)-benzenemethanol |
Application: | CysLT1 receptor antagonist |
CAS | 123226-28-8 |
MW: | 265.3 D |
From 60.00€
*
Item number: Cay15325-25
STO-609 is a calcium/calmodulin-dependent protein kinase kinase (CaMKK) inhibitor (IC50s = 120 and 40 ng/ml for CaMKKalpha and CaMKKbeta, respectively). It is selective for CaMKKs over CaMKI, CaMKII, CaMKIV, MLCK, PKC, PKA, and p42 MAPK (IC50s = > 10,000 ng/ml for all). STO-609 inhibits phosphorylation of CaMKI and...
Keywords: | 7-oxo-7H-benzimidazo[2,1-a]benz[de]isoquinoline-3-carboxylic acid, monoacetate |
CAS | 1173022-21-3 |
MW: | 374.4 D |
From 43.00€
*
Item number: Cay10325-1
Chemokine-Like Receptor 1 (CMKLR1) is a G protein-coupled receptor relevant to the cellular chemotaxis of dendritic cells and macrophages. This receptor is also expressed in brain, liver, lung, and kidney tissues. Chemerin, or TIG2, has been identified as the natural ligand for this receptor. Resolvin E1 has also...
Keywords: | Anti-CMKLR1, Anti-CHEMR23, Anti-Chemokine-like receptor 1, Anti-Chemokine-like receptor 1, Anti-G-protein coupled receptor... |
Application: | FC, IF, IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
422.00€
*
Item number: Cay13353-250
Lignoceric acid is a 24-carbon saturated (24:0) fatty acid. In mammals, it is synthesized during brain development and is found in cerebrosides. The deficient peroxisomal oxidation of very-long-chain fatty acids, including lignoceric acid, contributes to certain syndromes, including Zellweger cerebro-hepato-renal...
Keywords: | C24:0, tetracosanoic acid |
Application: | Bioactive lipid assays |
CAS | 557-59-5 |
MW: | 368.6 D |
From 24.00€
*
Item number: Cay17353-250
Orbifloxacin is a fluoroquinolone antibiotic used in animals, including dogs, cattle, and swine, to combat gastrointestinal and respiratory infections. It is effective against most Gram-negative bacteria, including Enterobacteriaceae and Pseudomonas, with lower activity against Gram-positive aerobes.Formal Name:...
Keywords: | CP 104,354, 1-cyclopropyl-7-[(3R,5S)-3,5-dimethyl-1-piperazinyl]-5,6,8-trifluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic acid |
Application: | Fluoroquinolone antibiotic, DNA gyrase inhibitor, Topoisomerase IV inhibitor |
CAS | 113617-63-3 |
MW: | 395.4 D |
From 60.00€
*
Item number: Cay35310-25
Nogo-66 (1-40) is a peptide fragment of Nogo-A that corresponds to the extracellular domain, Nogo-66, which can induce neurite growth cone collapse in oligodendrocytes. It is also an antagonist of the Nogo-66 receptor (NgR). It inhibits binding of the NgR agonist AP-Nogo-66 to, and inhibits growth cone collapse...
Keywords: | NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2,... |
Application: | Nogo-A peptide fragment |
MW: | 4739.1 D |
From 54.00€
*
Item number: Cay20353-25
UDP-N-acetyl-D-Glucosamine is a natural nucleotide sugar that is used by glycosyltransferases to transfer N-acetyl-D-glucosamine (Cay-13136) residues to substrates. It is an important component of antibiotic biosynthesis pathways in fungi and lipopolysaccharide production in bacteria.Formal Name: uridine...
Keywords: | UDPAG, UDP-GlcNAc, Uridine-5'-diphosphate-N-acetyl-D-Glucosamine, uridine 5'-(trihydrogen diphosphate),... |
Application: | O-GlcNAc transferase donor substrate |
MW: | 651.3 D |
From 50.00€
*