2 products were found matching "B0410.20"!
No results were found for the filter!
CXCL10 protein(N-His)(active) (recombinant mouse)
Item number: E-PKSM041503.20
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.2 µg/mL. Sequence: MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL...
| Keywords: | C7, Crg2, IP-10, Cxcl10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, Interferon-gamma induced... |
| Application: | Active, Cell culture |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 11.61 kD |
From 295.00€
*
Anti-CXCL14
Item number: E-AB-10342.20
This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a...
| Keywords: | Anti-MIP2G, Anti-MIP-2G, Anti-CXCL14, Anti-PSEC0212, Anti-Chemokine BRAK, Anti-C-X-C motif chemokine 14,... |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 71.00€
*
