3 products were found matching "97406.20"!
No results were found for the filter!
PSMB1, Recombinant, Human, aa29-241, GST-Tag (Proteasome...
Item number: 374906.20
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Source: Recombinant protein corresponding to...
| Keywords: | PSC5, PSMB1, Macropain subunit C5, Proteasome gamma chain, Proteasome component C5, Proteasome subunit beta type-1,... |
| MW: | 50,5 |
From 511.00€
*
Ly6e, Recombinant, Mouse, aa21-102, His-B2M-Tag...
Item number: 374096.20
Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Ly6e, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be...
| Keywords: | Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1 |
| MW: | 22,8 |
From 575.00€
*
Loxl1, Recombinant, Mouse, aa95-607, His-Tag (Lysyl...
Item number: 374069.20
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release...
| Keywords: | Lox2, Loxl1, EC=1.4.3.-, Lysyl oxidase 2, Lysyl oxidase homolog 1, Lysyl oxidase-like protein 1 |
| MW: | 58,45 |
From 497.00€
*
