- Search results for 97406.100
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
9 products were found matching "97406.100"!
Close filters
Filter by:
No results were found for the filter!
Item number: 374906.100
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Source: Recombinant protein corresponding to...
Keywords: | PSC5, PSMB1, Macropain subunit C5, Proteasome gamma chain, Proteasome component C5, Proteasome subunit beta type-1,... |
MW: | 50,5 |
From 511.00€
*
Item number: 374096.100
Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Ly6e, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be...
Keywords: | Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1 |
MW: | 22,8 |
From 575.00€
*
Item number: C7904-86.100
Control peptide for C7904-87. The prostanoid family includes PGD2, PGE2, PGF2alpha, PGI2, thromboxane A2 and prostaglandins. The prostaglandins (PGs) are implicated in various physiological and pathophysiological events, including male fertility, menstruation, ovulation, pregnancy, implantation and inflamatory and...
Application: | ELISA |
Origin: | bovine, chicken, horse, human, mouse, swine, rabbit, rat |
454.00€
*
Item number: 374069.100
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release...
Keywords: | Lox2, Loxl1, EC=1.4.3.-, Lysyl oxidase 2, Lysyl oxidase homolog 1, Lysyl oxidase-like protein 1 |
MW: | 58,45 |
From 497.00€
*
Item number: ATA-HPA039746.100
Protein function: Promotes phosphorylation of the Wnt coreceptor LRP6, leading to increased activity of the canonical Wnt signaling pathway (PubMed:18762581). Facilitates constitutive LRP6 phosphorylation by CDK14/CCNY during G2/M stage of the cell cycle, which may potentiate cells for Wnt signaling...
Keywords: | Anti-C1QDC1, Anti-Caprin-2, Anti-Protein EEG-1, Anti-RNA granule protein 140, Anti-C1q domain-containing protein 1,... |
Application: | ICC, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 335.00€
*
Item number: 100-401-406
Protein function: Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of...
Keywords: | Anti-NOTCH2 |
Application: | ELISA, IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
684.00€
*
Item number: 406066.100
Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation. Source: Recombinant protein corresponding to aa17-476 from mouse vitamin D-binding protein, fused to His-tag at N-terminal,...
Keywords: | Gc, VDB, DBP, Gc-globulin, Group-specific component, Vitamin D-binding protein |
MW: | 57,4 |
From 575.00€
*
Item number: 134062.100
Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
Application: | WB |
Host: | Rabbit |
Species reactivity: | human |
744.00€
*
Item number: 134063.100
Applications:, Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence:...
Application: | ELISA, IF, WB |
Host: | Mouse |
Species reactivity: | human |
699.00€
*