- Search results for A1000.1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
79 products were found matching "A1000.1"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG54163.100
Protein function: Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding...
Keywords: | Anti-ERBB, Anti-EGFR, EC=2.7.10.1, Anti-Proto-oncogene c-ErbB-1, Anti-Epidermal growth factor receptor, Anti-Receptor... |
Application: | ICC, IF, IHC (paraffin), IP, WB |
Host: | Mouse |
Species reactivity: | human |
624.00€
*
Item number: 208167.100
Application: | ELISA, WB |
Host: | Goat |
Species reactivity: | rat |
675.00€
*
Item number: 372853.100
Source:, Recombinant protein corresponding to aa110-417 from human Mast Cell Carboxypeptidase A fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~40kD, AA Sequence:...
Keywords: | CPA3, MC-CPA, EC=3.4.17.1, Carboxypeptidase A3, Mast cell carboxypeptidase A |
MW: | 40 |
From 511.00€
*
Item number: 372854.100
Source:, Recombinant protein corresponding to aa110-417 from human CPA3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~38kD, AA Sequence:...
Keywords: | CPA3, MC-CPA, EC=3.4.17.1, Carboxypeptidase A3, Mast cell carboxypeptidase A |
MW: | 38 |
From 531.00€
*
Item number: A110-123
Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also...
Keywords: | Anti-Tf, Anti-Transferrin, Anti-Siderophilin, Anti-Serotransferrin, Anti-Beta-1 metal-binding globulin, Anti-Liver... |
Application: | IEP, DD |
Host: | Goat |
Species reactivity: | rat |
111.00€
*
Item number: A110-124
Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also...
Keywords: | Anti-Tf, Anti-Transferrin, Anti-Siderophilin, Anti-Serotransferrin, Anti-Beta-1 metal-binding globulin, Anti-Liver... |
Application: | IEP, DD |
Host: | Rabbit |
Species reactivity: | rat |
139.00€
*
-10 %
Discount Promotion
Item number: ELK-ELK4262.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat S100A10. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat S100A10. Next,...
Keywords: | p11, S100a10, p10 protein, Protein S100-A10, Calpactin-1 light chain, Calpactin I light chain, Cellular ligand of annexin... |
Application: | ELISA |
Species reactivity: | rat |
365.00€
*
From 328.50€
*
-10 %
Discount Promotion
Item number: ELK-ELK1361.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A10. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A10....
Keywords: | p11, ANX2LG, S100A10, p10 protein, Protein S100-A10, Calpactin-1 light chain, Calpactin I light chain, Cellular ligand of... |
Application: | ELISA |
Species reactivity: | human |
303.00€
*
From 272.70€
*
-10 %
Discount Promotion
Item number: ELK-ELK1362.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse S100A10. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse S100A10....
Keywords: | p11, Cal1l, S100a10, p10 protein, Protein S100-A10, Calpactin-1 light chain, Calpactin I light chain, Cellular ligand of... |
Application: | ELISA |
Species reactivity: | mouse |
303.00€
*
From 272.70€
*
Item number: 405978.100
Source:, Recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS,...
Keywords: | LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1... |
MW: | 15,5 |
From 511.00€
*