79 products were found matching "A1000.1"!

1 from 7 pages
No results were found for the filter!
Anti-EGFR, clone 3F12-1H7-A10
Anti-EGFR, clone 3F12-1H7-A10

Item number: ARG54163.100

Protein function: Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding...
Keywords: Anti-ERBB, Anti-EGFR, EC=2.7.10.1, Anti-Proto-oncogene c-ErbB-1, Anti-Epidermal growth factor receptor, Anti-Receptor...
Application: ICC, IF, IHC (paraffin), IP, WB
Host: Mouse
Species reactivity: human
624.00€ *
Review
Anti-Galectin-1, aa100-112 (Lgals1, Lectin, Galactose binding, soluble 1, AA410090, Gal-1, Galbp, L-
Anti-Galectin-1, aa100-112 (Lgals1, Lectin, Galactose...

Item number: 208167.100

Application: ELISA, WB
Host: Goat
Species reactivity: rat
675.00€ *
Review
CPA3, Recombinant, Human, aa110-417, His-Tag (Mast Cell Carboxypeptidase A)
CPA3, Recombinant, Human, aa110-417, His-Tag (Mast Cell...

Item number: 372853.100

Source:, Recombinant protein corresponding to aa110-417 from human Mast Cell Carboxypeptidase A fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~40kD, AA Sequence:...
Keywords: CPA3, MC-CPA, EC=3.4.17.1, Carboxypeptidase A3, Mast cell carboxypeptidase A
MW: 40
From 511.00€ *
Review
CPA3, Recombinant, Human, aa110-417, His-Tag (Mast Cell Carboxypeptidase A)
CPA3, Recombinant, Human, aa110-417, His-Tag (Mast Cell...

Item number: 372854.100

Source:, Recombinant protein corresponding to aa110-417 from human CPA3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~38kD, AA Sequence:...
Keywords: CPA3, MC-CPA, EC=3.4.17.1, Carboxypeptidase A3, Mast cell carboxypeptidase A
MW: 38
From 531.00€ *
Review
Tween 20
Tween 20

Item number: BR-A12000.1

21.00€ *
Review
Wash Buffer
Wash Buffer

Item number: BR-A17000.1

12.00€ *
Review
Anti-Rat Transferrin
Anti-Rat Transferrin

Item number: A110-123

Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also...
Keywords: Anti-Tf, Anti-Transferrin, Anti-Siderophilin, Anti-Serotransferrin, Anti-Beta-1 metal-binding globulin, Anti-Liver...
Application: IEP, DD
Host: Goat
Species reactivity: rat
111.00€ *
Review
Anti-Rat Transferrin
Anti-Rat Transferrin

Item number: A110-124

Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also...
Keywords: Anti-Tf, Anti-Transferrin, Anti-Siderophilin, Anti-Serotransferrin, Anti-Beta-1 metal-binding globulin, Anti-Liver...
Application: IEP, DD
Host: Rabbit
Species reactivity: rat
139.00€ *
Review
-10 %
Discount Promotion
Rat S100A10 (S100 Calcium Binding Protein A10) ELISA Kit
Rat S100A10 (S100 Calcium Binding Protein A10) ELISA Kit

Item number: ELK-ELK4262.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat S100A10. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat S100A10. Next,...
Keywords: p11, S100a10, p10 protein, Protein S100-A10, Calpactin-1 light chain, Calpactin I light chain, Cellular ligand of annexin...
Application: ELISA
Species reactivity: rat
365.00€ * From 328.50€ *
Review
-10 %
Discount Promotion
Human S100A10 (S100 Calcium Binding Protein A10) ELISA Kit
Human S100A10 (S100 Calcium Binding Protein A10) ELISA Kit

Item number: ELK-ELK1361.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A10. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A10....
Keywords: p11, ANX2LG, S100A10, p10 protein, Protein S100-A10, Calpactin-1 light chain, Calpactin I light chain, Cellular ligand of...
Application: ELISA
Species reactivity: human
303.00€ * From 272.70€ *
Review
-10 %
Discount Promotion
Mouse S100A10 (S100 Calcium Binding Protein A10) ELISA Kit
Mouse S100A10 (S100 Calcium Binding Protein A10) ELISA Kit

Item number: ELK-ELK1362.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse S100A10. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse S100A10....
Keywords: p11, Cal1l, S100a10, p10 protein, Protein S100-A10, Calpactin-1 light chain, Calpactin I light chain, Cellular ligand of...
Application: ELISA
Species reactivity: mouse
303.00€ * From 272.70€ *
Review
Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa10-104, His-B2M-JD-tag (LY6G6D
Lymphocyte Antigen 6 Complex Locus Protein G6d,...

Item number: 405978.100

Source:, Recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS,...
Keywords: LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1...
MW: 15,5
From 511.00€ *
Review
1 from 7 pages