5 products were found matching "5875-1"!

No results were found for the filter!
Gossypol-acetic acid
Gossypol-acetic acid

Item number: LKT-G5875.1

A potential male anti-fertility agent from cotton that exhibits a wide spectrum of toxicity. It was found to have cytotoxic effects on human cancer cell lines. It is a potent telomerase inhibitor.
Keywords: 1,1',6,6',7,7'-Hexahydroxy-3,3'-dimethyl-5,5'-bis(1- methylethyl)(2,2'-binaphthalene)-8,8'-dicarboxaldehyde-acetic acid,...
Application: Telomerase inhibitor
CAS 12542-36-8
MW: 578,61 D
From 146.00€ *
Review
Anti-ABCD1
Anti-ABCD1

Item number: E-AB-65875.120

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a...
Keywords: Anti-ALD, Anti-ALDP, Anti-Adrenoleukodystrophy protein, Anti-ATP-binding cassette sub-family D member 1, ABCD1 Polyclonal...
Application: IF
Host: Rabbit
Species reactivity: human, mouse, rat
From 198.00€ *
Review
epi-Testosterone
epi-Testosterone

Item number: Cay15875-1

epi-Testosterone (Cay-15875) is an analytical reference material categorized as an anabolic androgenic steroid. epi-Testosterone has been used as a masking agent for testosterone in sports doping. epi-Testosterone is regulated as a Schedule III compound in the United States. This product is intended for research and...
Keywords: iso-Testosterone, Epitestosterone, NSC 26499, 17alpha-hydroxy-androst-4-en-3-one
Application: Analytical reference material, Anabolic androgenic steroid
CAS 481-30-1
MW: 288.4 D
From 65.00€ *
Review
Anti-SLC8A1 (Sodium/Calcium Exchanger 1, Na(+)/Ca(2+)-Exchange Protein 1, Solute Carrier Family 8 Me
Anti-SLC8A1 (Sodium/Calcium Exchanger 1,...

Item number: 225875.100

Application: WB
Host: Rabbit
Species reactivity: human, mouse, rat
From 516.00€ *
Review
Anti-DLEU1 (Leukemia-associated Protein 1, Deleted in Lymphocytic Leukemia 1, HBV X-transactivated G
Anti-DLEU1 (Leukemia-associated Protein 1, Deleted in...

Item number: 125875.100

May act as a tumor suppressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY, Storage and Stability: May...
Application: ELISA, WB
Host: Mouse
Species reactivity: human
699.00€ *
Review