- Search results for 5488-1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "5488-1"!
Close filters
Filter by:
No results were found for the filter!
Item number: Cay15488-1
AMB (Cay-15488) is an analytical reference standard categorized as a synthetic cannabinoid. This product is intended for research and forensic applications.Formal Name: N-[(1-pentyl-1H-indazol-3-yl)carbonyl]-L-valine, methyl ester. CAS Number: 1890250-13-1. Molecular Formula: C19H27N3O3. Formula Weight: 345.4....
Keywords: | AMB-PINACA, AMP, MMB-PINACA, N-[(1-pentyl-1H-indazol-3-yl)carbonyl]-L-valine, methyl ester |
Application: | Analytical reference standard, synthetic cannabinoid AB-PINACA analog |
CAS | 1890250-13-1 |
MW: | 345.4 D |
From 84.00€
*
Item number: Cay25488-1
Heptanoyl fentanyl (hydrochloride) (Cay-25488) is an analytical reference standard that is structurally similar to known opioids. Heptanoyl fentanyl is regulated as a Schedule I compound in the United States. This product is intended for research and forensic applications.Formal Name:...
Keywords: | N-(1-phenethylpiperidin-4-yl)-N-phenylheptanamide |
Application: | Analytical reference standard, Structurally similar to known opioids |
CAS | 2749326-85-8 |
MW: | 429 D |
From 291.00€
*
Item number: VMPS-5488
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Kpc1, Rnf123, EC=6.3.2.-, RING finger protein 123, E3 ubiquitin-protein ligase RNF123, Kip1 ubiquitination-promoting... |
Application: | RNA quantification |
43.00€
*
Item number: VRPS-5488
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Sema5a, RCG53309, rCG_53309 |
Application: | RNA quantification |
52.00€
*
Item number: 145488.100
HMGB1 is a non-histone chromosomal protein that functions in endotoxin lethality. It is released from activated macrophages and is present at elevated levels in the serum of sepsis patients. HMGB1 was also reported to interact with RAGE (receptor for advanced glycation end products) and to influence neuron...
Application: | FC |
Host: | Mouse |
Species reactivity: | human |
871.00€
*
Item number: 135488.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH*, Storage and Stability: May be...
Application: | ELISA, WB |
Host: | Mouse |
Species reactivity: | human, mouse, rat |
699.00€
*
Item number: Cay35488-10
Belotecan is an inhibitor of DNA topoisomerase I (IC50 = 0.119 µg/ml) and a derivative of the DNA topoisomerase I inhibitor camptothecin (Cay-11694). It inhibits the proliferation of various cancer cell lines, including KATO III stomach, HT-29 colon, A549 lung, MDA-MB-231 breast, and SKOV3 ovarian cancer cells...
Keywords: | (S)-CKD602, 7-[2-(N-isopropylamino)ethyl]-(20S)-Camptothecin, CKD602,... |
Application: | DNA topoisomerase I inhibitor |
CAS | 213819-48-8 |
MW: | 470 D |
From 129.00€
*
Item number: NSJ-F54881-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. BGN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached...
Keywords: | Anti-BGN, Anti-PG-S1, Anti-SLRR1A, Anti-Biglycan, Anti-Bone/cartilage proteoglycan I, BGN Antibody / Biglycan |
Application: | FC, IHC (paraffin), WB |
Host: | Rabbit |
Species reactivity: | human |
From 326.00€
*