7 products were found matching "Cay10353-25"!

No results were found for the filter!
17-phenyl trinor Prostaglandin E2 ethyl amide
17-phenyl trinor Prostaglandin E2 ethyl amide

Item number: Cay13532-5

17-phenyl trinor PGE2 ethyl amide is derived from 17-phenyl trinor PGE2, a synthetic analog of PGE2 that acts as an agonist of EP1 and EP3 receptors in mice (Ki = 14 and 3.7 nM, respectively) and EP1, EP3, and EP4 in rats (Ki = 25, 4.3, and 54 nM, respectively). 17-phenyl trinor PGE2 causes contraction of guinea pig...
Keywords: 17-phenyl trinor PGE2 ethyl amide, N-ethyl-9-oxo-11alpha,15S-dihydroxy-17-phenyl-18,19,20-trinor-prosta-5Z,13E-dien-1-amide
Application: EP1/EP3 agonist
CAS 1219032-20-8
MW: 413.6 D
From 126.00€ *
Review
CAY10789
CAY10789

Item number: Cay35325-10

CAY10789 is an antagonist of the cysteinyl leukotriene 1 (CysLT1) receptor (IC50 = 2.1 µM).Formal Name: 3-(2-quinolinylmethoxy)-benzenemethanol. CAS Number: 123226-28-8. Synonyms: [3-(Quinolin-2-ylmethoxy)phenyl]methanol. Molecular Formula: C17H15NO2. Formula Weight: 265.3. Purity: >98%. Formulation: (Request...
Keywords: [3-(Quinolin-2-ylmethoxy)phenyl]methanol, 3-(2-quinolinylmethoxy)-benzenemethanol
Application: CysLT1 receptor antagonist
CAS 123226-28-8
MW: 265.3 D
From 60.00€ *
Review
STO-609 (acetate)
STO-609 (acetate)

Item number: Cay15325-25

STO-609 is a calcium/calmodulin-dependent protein kinase kinase (CaMKK) inhibitor (IC50s = 120 and 40 ng/ml for CaMKKalpha and CaMKKbeta, respectively). It is selective for CaMKKs over CaMKI, CaMKII, CaMKIV, MLCK, PKC, PKA, and p42 MAPK (IC50s = > 10,000 ng/ml for all). STO-609 inhibits phosphorylation of CaMKI and...
Keywords: 7-oxo-7H-benzimidazo[2,1-a]benz[de]isoquinoline-3-carboxylic acid, monoacetate
CAS 1173022-21-3
MW: 374.4 D
From 43.00€ *
Review
Anti-Chemokine-Like Receptor 1
Anti-Chemokine-Like Receptor 1

Item number: Cay10325-1

Chemokine-Like Receptor 1 (CMKLR1) is a G protein-coupled receptor relevant to the cellular chemotaxis of dendritic cells and macrophages. This receptor is also expressed in brain, liver, lung, and kidney tissues. Chemerin, or TIG2, has been identified as the natural ligand for this receptor. Resolvin E1 has also...
Keywords: Anti-CMKLR1, Anti-CHEMR23, Anti-Chemokine-like receptor 1, Anti-Chemokine-like receptor 1, Anti-G-protein coupled receptor...
Application: FC, IF, IHC, WB
Host: Rabbit
Species reactivity: human
422.00€ *
Review
Orbifloxacin
Orbifloxacin

Item number: Cay17353-250

Orbifloxacin is a fluoroquinolone antibiotic used in animals, including dogs, cattle, and swine, to combat gastrointestinal and respiratory infections. It is effective against most Gram-negative bacteria, including Enterobacteriaceae and Pseudomonas, with lower activity against Gram-positive aerobes.Formal Name:...
Keywords: CP 104,354, 1-cyclopropyl-7-[(3R,5S)-3,5-dimethyl-1-piperazinyl]-5,6,8-trifluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic acid
Application: Fluoroquinolone antibiotic, DNA gyrase inhibitor, Topoisomerase IV inhibitor
CAS 113617-63-3
MW: 395.4 D
From 60.00€ *
Review
Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)
Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

Item number: Cay35310-25

Nogo-66 (1-40) is a peptide fragment of Nogo-A that corresponds to the extracellular domain, Nogo-66, which can induce neurite growth cone collapse in oligodendrocytes. It is also an antagonist of the Nogo-66 receptor (NgR). It inhibits binding of the NgR agonist AP-Nogo-66 to, and inhibits growth cone collapse...
Keywords: NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2,...
Application: Nogo-A peptide fragment
MW: 4739.1 D
From 54.00€ *
Review
UDP-N-acetyl-D-Glucosamine (sodium salt hydrate)
UDP-N-acetyl-D-Glucosamine (sodium salt hydrate)

Item number: Cay20353-25

UDP-N-acetyl-D-Glucosamine is a natural nucleotide sugar that is used by glycosyltransferases to transfer N-acetyl-D-glucosamine (Cay-13136) residues to substrates. It is an important component of antibiotic biosynthesis pathways in fungi and lipopolysaccharide production in bacteria.Formal Name: uridine...
Keywords: UDPAG, UDP-GlcNAc, Uridine-5'-diphosphate-N-acetyl-D-Glucosamine, uridine 5'-(trihydrogen diphosphate),...
Application: O-GlcNAc transferase donor substrate
MW: 651.3 D
From 50.00€ *
Review