6 products were found matching "5676-1"!

No results were found for the filter!
Anti-IFNA1
Anti-IFNA1

Item number: E-AB-65676.120

The protein encoded by this gene is produced by macrophages and has antiviral activity. This gene is intronless and the encoded protein is secreted. Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an...
Keywords: Anti-IFNA1, Anti-LeIF D, Anti-IFNA13, Anti-IFN-alpha-1/13, Anti-Interferon alpha-D, Anti-Interferon alpha-1/13, IFNA1...
Application: IF
Host: Rabbit
Species reactivity: human, mouse, rat
From 198.00€ *
Review
EPZ-5676
EPZ-5676

Item number: LKT-E6398.1

EPZ-5676 is an inhibitor of DOT1L histone methyltransferase (HMT) that exhibits anticancer chemotherapeutic activity. In acute myelogenous leukemia (AML) cells with MLL gene translocations, EPZ-5676 displays cytotoxicity, in similar animal models, this compound induces tumor regression without toxicity.
Application: DOT1L inhibitor
CAS 1380288-87-8
MW: 562.71 D
From 229.00€ *
Review
MFAP2, Human microfibrillar-associated protein 2, Real Time PCR Primer Set
MFAP2, Human microfibrillar-associated protein 2, Real...

Item number: VHPS-5676

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: MAGP, MFAP2, MAGP1, MAGP-1, MFAP-2, Microfibrillar-associated protein 2, Microfibril-associated glycoprotein 1
Application: RNA quantification
43.00€ *
Review
-10 %
Discount Promotion
Anti-phospho-Rac GAP1 (Ser387)
Anti-phospho-Rac GAP1 (Ser387)

Item number: ELK-ES5676.100

This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and...
Keywords: Anti-phospho-CYK4, Anti-phospho-HsCYK-4, Anti-phospho-MgcRacGAP, Anti-phospho-Protein CYK4 homolog, Anti-phospho-Male germ...
Application: WB, IHC, IF, ELISA
Host: Rabbit
Species reactivity: human, mouse, rat, monkey
169.00€ * From 152.10€ *
Review
Anti-DCST1 (DC-STAMP Domain-containing Protein 1, FLJ32785, RP11-307C12.10)
Anti-DCST1 (DC-STAMP Domain-containing Protein 1,...

Item number: 125676.100

Applications:, Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLKKRAAFTKLRRAAILRRERQQKAPRHPLADI, Storage and Stability: May be stored at 4°C for...
Application: ELISA
Host: Mouse
Species reactivity: human
699.00€ *
Review
Anti-ZNF281 (Zinc Finger Protein 281, GC-box-binding Zinc Finger Protein 1, GZP1, Transcription Fact
Anti-ZNF281 (Zinc Finger Protein 281, GC-box-binding Zinc...

Item number: 135676.100

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQS*, Storage and Stability: May...
Application: ELISA, WB
Host: Mouse
Species reactivity: human
699.00€ *
Review