- Search results for 5875-1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
5 products were found matching "5875-1"!
Close filters
Filter by:
No results were found for the filter!
Item number: LKT-G5875.1
A potential male anti-fertility agent from cotton that exhibits a wide spectrum of toxicity. It was found to have cytotoxic effects on human cancer cell lines. It is a potent telomerase inhibitor.
Keywords: | 1,1',6,6',7,7'-Hexahydroxy-3,3'-dimethyl-5,5'-bis(1- methylethyl)(2,2'-binaphthalene)-8,8'-dicarboxaldehyde-acetic acid,... |
Application: | Telomerase inhibitor |
CAS | 12542-36-8 |
MW: | 578,61 D |
From 146.00€
*
Item number: E-AB-65875.120
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a...
Keywords: | Anti-ALD, Anti-ALDP, Anti-Adrenoleukodystrophy protein, Anti-ATP-binding cassette sub-family D member 1, ABCD1 Polyclonal... |
Application: | IF |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 198.00€
*
Item number: Cay15875-1
epi-Testosterone (Cay-15875) is an analytical reference material categorized as an anabolic androgenic steroid. epi-Testosterone has been used as a masking agent for testosterone in sports doping. epi-Testosterone is regulated as a Schedule III compound in the United States. This product is intended for research and...
Keywords: | iso-Testosterone, Epitestosterone, NSC 26499, 17alpha-hydroxy-androst-4-en-3-one |
Application: | Analytical reference material, Anabolic androgenic steroid |
CAS | 481-30-1 |
MW: | 288.4 D |
From 65.00€
*
Item number: 225875.100
Application: | WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 516.00€
*
Item number: 125875.100
May act as a tumor suppressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY, Storage and Stability: May...
Application: | ELISA, WB |
Host: | Mouse |
Species reactivity: | human |
699.00€
*