11 products were found matching "5777-1"!

No results were found for the filter!
BMS-299897
BMS-299897

Item number: Cay35777-1

BMS-299897 is an inhibitor of gamma-secretase. It selectively cleaves the carboxy terminal fragment (CTF) of amyloid precursor protein (APP) over the Notch-1 CTF in HEK293 cells (IC50s = 7.1 and 105.9 nM, respectively). BMS-299897 (0.1-1 nmol/animal) reduces increases in amyloid-beta (1-42) (Abeta42) levels induced...
Keywords: 2-[(1R)-1-[[(4-chlorophenyl)sulfonyl](2,5-difluorophenyl)amino]ethyl]-5-fluoro-benzenebutanoic acid
Application: Gamma-secretase inhibitor
CAS 290315-45-6
MW: 511.9 D
From 39.00€ *
Review
Sepw1, Mouse selenoprotein W, muscle 1, Real Time PCR Primer Set
Sepw1, Mouse selenoprotein W, muscle 1, Real Time PCR...

Item number: VMPS-5777

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Selw, SelW, Sepw1, Selenoprotein W
Application: RNA quantification
43.00€ *
Review
Anti-SGK 1 (Serine/threonine Protein Kinase SGK, Serine/threonine Protein Kinase Sgk1, Serine/threon
Anti-SGK 1 (Serine/threonine Protein Kinase SGK,...

Item number: 225777.100

Application: IF, IHC, WB
Host: Rabbit
Species reactivity: human, mouse, rat
From 516.00€ *
Review
Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)
Uncharacterized Protein C4orf3, Recombinant, Human,...

Item number: 375777.100

Source:, Recombinant protein corresponding to aa1-44 from human C4orf3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.8kD, AA Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing...
Keywords: C4orf3, Uncharacterized protein C4orf3, HCV F-transactivated protein 1, Hepatitis C virus F protein-transactivated protein 1
MW: 20,8
From 511.00€ *
Review
4-(Methylsulfinyl) butylamine
4-(Methylsulfinyl) butylamine

Item number: LKT-M185777.100

4-(Methylsulfinyl) butylamine is the synthetic precursor of sulforaphane.
Keywords: Schembl371434, CTK7E8172, 4-methanesulfinylbutan-1-amine, (+/-)-1-amino-4-(methylsulfinyl)butane,...
Application: Synthetic sulforaphane precursor
CAS 187587-70-8
MW: 135.23 D
From 77.00€ *
Review
Sabinene
Sabinene

Item number: Cay25777-100

Sabinene is a bicyclic monoterpene found in a variety of plants, including Cannabis, that has antifungal and anti-inflammatory properties. It inhibits the growth of various fungi in vitro, including several species of Candida, Trichophyton, and Aspergillus (MICs = 0.16-5 µl/ml). Sabinene (0.32 µl/ml) prevents...
Keywords: NSC 407278, 4-methylene-1-(1-methylethyl)-bicyclo[3.1.0]hexane
Application: Bioactive bicyclic monoterpene, Antifungal, Antiinflammatory
CAS 3387-41-5
MW: 136.2 D
From 80.00€ *
Review
40S Ribosomal Protein SA, Recombinant, Human, aa2-295, His-Tag, Myc-Tag (RPSA)
40S Ribosomal Protein SA, Recombinant, Human, aa2-295,...

Item number: 517777.100

Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane...
Keywords: LamR, 67LR, LAMBR, 37LRP, LRP/LR, LBP/p40, NEM/1CHD4, Laminin receptor 1, 67 kDa laminin receptor, 40S ribosomal protein...
Expressed in: E.coli
Origin: human
MW: 37.7 kD
From 575.00€ *
Review
Cucurbitacin I
Cucurbitacin I

Item number: Cay14747-1

Cucurbitacin I is triterpenoid compound that acts as a potent inhibitor of the STAT3/JAK signaling pathway. It specifically suppresses levels of tyrosine phosphorylated STAT3 in v-Src-transformed NIH 3T3 cells and in A549 cells (IC50 = 500 nM) resulting in inhibition of STAT3 DNA binding and reduced STAT3-mediated...
Keywords: Elatericin B, JSI-124, NSC 521777,...
Application: STAT3/JAK signaling pathway inhibitor
CAS 2222-07-3
MW: 514.7 D
From 129.00€ *
Review
Tipifarnib
Tipifarnib

Item number: Cay11747-5

Tipifarnib is a nonpeptidomimetic, CAAX-competitive inhibitor of farnesyltransferase (IC50 = 0.86 nM). It prevents farnesylation of Ras GTPases and has shown potent efficacy in various in vitro and in vivo tumor models.Formal Name:...
Keywords: R 115777, 6-[(R)-amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone
Application: CAAX-competitive farnesyltransferase inhibitor, Ras GTPase farnesylation inhibitor
CAS 192185-72-1
MW: 489.4 D
From 60.00€ *
Review
(S)-Tipifarnib
(S)-Tipifarnib

Item number: Cay35515-1

(S)-Tipifarnib is an inactive enantiomer of tipifarnib (Cay-11747).Formal Name: 6-[(S)-amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone. CAS Number: 192185-71-0. Synonyms: (S)-(-)-R 115777. Molecular Formula: C27H22Cl2N4O. Formula Weight: 489.4. Purity: >98%....
Keywords: (S)-(-)-R 115777,...
Application: Inactive enantiomer
CAS 192185-71-0
MW: 489.4 D
From 69.00€ *
Review
Anti-Beta Tubulin / TUBB1
Anti-Beta Tubulin / TUBB1

Item number: NSJ-RQ5777

0.5mg/ml if reconstituted with 0.2ml sterile DI water. TUBB1 is a gene that codes for the protein Tubulin beta-1 chain in humans. This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form...
Keywords: Anti-TUBB1, Anti-Tubulin beta-1 chain, Beta Tubulin Antibody / TUBB1
Application: WB, IF, FC, IHC (paraffin), Direct ELISA
Host: Rabbit
Species reactivity: human, mouse, rat
755.00€ *
Review