Für die Filterung wurden keine Ergebnisse gefunden!
IL-6 protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000005.20
Activity: Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this effect is <1.5 ng/mL. Sequence:...
| Schlagworte: | IL6, IL-6, Interleukin-6, Recombinant Swine IL-6 protein(N-His)(active) |
| Anwendung: | Active, Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 24.78 kD |
588,00 €
IL-8 protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000006.20
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ. Fusion tag: N-His Endotoxin: Please contact us for more information....
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | Active, Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 12.46 kD |
588,00 €
TNF alpha protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000010.20
Activity: Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is <15 pg/mL. Sequence:...
| Schlagworte: | TNF, TNFA, Recombinant Swine TNF alpha protein(N-His)(active) |
| Anwendung: | Active, Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 26.08 kD |
588,00 €
EGF protein(N-His) (recombinant swine)
Artikelnummer: E-PKSS000015.100
Sequence:...
| Schlagworte: | EGF, Recombinant Swine EGF protein(N-His) |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 134.35 kD |
ab 236,00 €
Recombinant Rabbit TNF-alpha/TNFSF2/TNFa Protein (RPES3618)
Artikelnummer: G-RPES3618.10
Rabbit TNF-alpha/TNFSF2/TNFa Recombinant Protein (RPES3618) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell...
| Schlagworte: | TNF, TNFA |
| Exprimiert in: | E.coli |
| Ursprungsart: | rabbit |
256,00 €
Recombinant Human ECH1 Protein (RPES3719)
Artikelnummer: G-RPES3719.10
Human ECH1 Recombinant Protein (RPES3719) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Isomerization of 3-trans,5-cis-dienoyl-CoA to 2-trans,4- trans-dienoyl-CoA. [The UniProt Consortium]
| Schlagworte: | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
427,00 €
Recombinant Human Sonic Hedgehog/SHH Protein (aa 197, His...
Artikelnummer: G-RPES3795.20
Protein function: [Sonic hedgehog protein]: The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a...
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
438,00 €
Recombinant Human FGF0/FGF10 Protein (RPES3823)
Artikelnummer: G-RPES3823.10
Human FGF0/FGF10 Recombinant Protein (RPES3823) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching...
| Schlagworte: | FGF10, FGF-10, Fibroblast growth factor 10, Keratinocyte growth factor 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
234,00 €
Recombinant Human Eotaxin-3/CCL26 Protein (aa 24-94)...
Artikelnummer: G-RPES3833.10
Human Eotaxin-3/CCL26 Recombinant Protein (RPES3833) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Chemoattractant for eosinophils and basophils (PubMed:10415065, PubMed:10488147). Acts as a ligand for C-C chemokine receptor CCR3 which triggers...
| Schlagworte: | CCL26, TSC-1, SCYA26, Eotaxin-3, MIP-4-alpha, CC chemokine IMAC, C-C motif chemokine 26, Thymic stroma chemokine-1,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
438,00 €
Recombinant Human LTBR/TNFRSF3 Protein (His Tag) (RPES3890)
Artikelnummer: G-RPES3890.10
Human LTBR/TNFRSF3 Recombinant Protein (RPES3890) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the...
| Schlagworte: | LTBR, D12S370, TNF-RIII, TNFR-III, Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor... |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
138,00 €
Recombinant Rat IL-6/Interleukin-6 Protein (Active)...
Artikelnummer: G-RPES3914.20
Rat IL-6/Interleukin-6 Recombinant Protein (RPES3914) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to...
| Schlagworte: | IL-6, Il-6, Interleukin-6 |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
534,00 €
IGF-I protein(N-His) (recombinant swine)
Artikelnummer: E-PKSS000020.20
Sequence: MGKISSLPTQLFKCCFCDFLKVKMHITSSSHLFYLALCLLSFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEVHLKNTSRGSSGNKNYRM. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: The insulin-like growth factors, isolated from...
| Schlagworte: | IGF1, IGF-I, Somatomedin, Insulin-like growth factor I, Recombinant Swine IGF-I protein(N-His) |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 17.83 kD |
588,00 €