Für die Filterung wurden keine Ergebnisse gefunden!
GM-CSF protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000024.20
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Anwendung: | Active, Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 17.08 kD |
588,00 €
Recombinant Human RAC2 Protein (His Tag) (RPES3620)
Artikelnummer: G-RPES3620.20
Human RAC2 Recombinant Protein (RPES3620) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector...
| Schlagworte: | GX, RAC2, p21-Rac2, Small G protein, Ras-related C3 botulinum toxin substrate 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
1.165,00 €
Recombinant Mouse VEGF-A/VEGF164 Protein (RPES3678)
Artikelnummer: G-RPES3678.10
Mouse VEGF-A/VEGF164 Recombinant Protein (RPES3678) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration,...
| Schlagworte: | VPF, Vegf, Vegfa, VEGF-A, Vascular permeability factor, Vascular endothelial growth factor A |
| Exprimiert in: | Pichia pastoris |
| Ursprungsart: | mouse |
299,00 €
Recombinant Human NKG2D/CD314 Protein (His Tag)(Active)...
Artikelnummer: G-RPES3681.10
Human NKG2D/CD314 Recombinant Protein (RPES3681) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress- inducible ligands displayed...
| Schlagworte: | KLRK1, CD314, D12S2489E, NK cell receptor D, NKG2-D-activating NK receptor, NKG2-D type II integral membrane protein,... |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
224,00 €
Recombinant Mouse VEGF-D/VEGFD Protein (His Tag) (RPES3700)
Artikelnummer: G-RPES3700.10
Mouse VEGF-D/VEGFD Recombinant Protein (RPES3700) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects...
| Schlagworte: | Figf, FIGF, VEGF-D, c-Fos-induced growth factor, Vascular endothelial growth factor D |
| Exprimiert in: | Human cells |
| Ursprungsart: | mouse |
234,00 €
Recombinant Human VEGF-B/VEGFB Protein (Fc Tag) (RPES3768)
Artikelnummer: G-RPES3768.10
Human VEGF-B/VEGFB Recombinant Protein (RPES3768) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by...
| Schlagworte: | VRF, VEGFB, VEGF-B, VEGF-related factor, Vascular endothelial growth factor B |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
234,00 €
Recombinant Human VEGF165/VEGFA Protein (Active) (RPES3789)
Artikelnummer: G-RPES3789.10
Human VEGF165/VEGFA Recombinant Protein (RPES3789) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration,...
| Schlagworte: | VPF, VEGF, VEGFA, VEGF-A, Vascular permeability factor, Vascular endothelial growth factor A |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
299,00 €
Recombinant Rat TNF-alpha/TNFA Protein (Active) (RPES3826)
Artikelnummer: G-RPES3826.5
Rat TNF-alpha/TNFA Recombinant Protein (RPES3826) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It...
| Schlagworte: | Tnf, Tnfa |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
438,00 €
Recombinant Human Retinol-Binding Protein 2/RBP2 Protein...
Artikelnummer: G-RPES3846.10
Human RBP2 Recombinant Protein (RPES3846) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Intracellular transport of retinol. [The UniProt Consortium]
| Schlagworte: | RBP2, CRBP2, CRBP-II, Retinol-binding protein 2, Cellular retinol-binding protein II |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
224,00 €
Recombinant Rat IL beta/IL1B Protein (mature...
Artikelnummer: G-RPES3892.20
Rat IL beta/IL1B Recombinant Protein (RPES3892) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation,...
| Schlagworte: | IL-1 beta, Interleukin-1 beta |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
534,00 €
Recombinant Human Catalase/CAT Protein (RPES3921)
Artikelnummer: G-RPES3921.10
Human Catalase/CAT Recombinant Protein (RPES3921) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells...
| Schlagworte: | CAT, Catalase, EC=1.11.1.6 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
363,00 €
Recombinant Human Interleukin-2/IL-2 Protein...
Artikelnummer: G-RPES4026.10
Interleukin-2/IL-2 Recombinant Protein (E.coli) (RPES4026) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities...
| Schlagworte: | IL2, IL-2, TCGF, Aldesleukin, Interleukin-2, T-cell growth factor |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
202,00 €