Für die Filterung wurden keine Ergebnisse gefunden!
GPC3 Stable Cell Line
Artikelnummer: ABE-14-518ACL
GPC3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Glypican 3 (GPC3, also known as GTR2-2, OCI-5 and MXR7). Sequence data: hGPC3 (accession number NM_004484) MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQR LQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKF...
| Anwendung: | FA |
4.103,00 €
VISTA Stable Cell Line-H
Artikelnummer: ABE-14-519ACL
VISTA Stable Cell Line-H is a stably transfected HEK293 cell line which expresses human V-type immunoglobulin domain-containing suppressor of T-cell activation (VISTA, also known as VSIR, B7-H5, PD-1H, and SISP1). Sequence data: hVISTA (accession number NM_022153) MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVC...
| Anwendung: | FA |
4.103,00 €
TIM-3 Stable Cell Line
Artikelnummer: ABE-14-520ACL
TIM-3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human T-cell immunoglobulin and mucin-domain containing-3 (TIM-3, also known as HAVCR2 and CD366). Sequence data: hTIM-3 (accession number NM_032782) MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAA...
| Anwendung: | FA |
4.103,00 €
B7-H3 Stable Cell Line
Artikelnummer: ABE-14-521ACL
B7-H3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human B7-H3 (also known as CD276). Sequence data: hB7-H3 (accession number NM_001024736) MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGT DATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ...
| Anwendung: | FA |
4.103,00 €
A2AR Stable Cell Line
Artikelnummer: ABE-14-522ACL
A2AR Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human adenosine A2A receptor (A2AR, also known as ADORA2A). Sequence data: hA2AR (accession number BC013780) MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYF VVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDR...
| Anwendung: | FA |
4.103,00 €
ACE2/CHO-K1 Stable Cell Line
Artikelnummer: ABE-14-523ACL
ACE2 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal amino...
| Anwendung: | FA |
4.103,00 €
ACE2/HEK293 Stable Cell Line
Artikelnummer: ABE-14-524ACL
ACE2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal...
| Anwendung: | FA |
4.103,00 €
Cas9-Expressing A549 Cell line - High expression
Artikelnummer: BPS-78134-H
This cell line is a clonal derivative from the Cas9-Expressing A549 Cell Pool (BPS-78072). It was generated by limited dilution of the original pool and isolation of individual clones, which were screened based on Cas9 expression to obtain a high-expressing cell line. The expressed Cas9 protein includes a C-terminal...
| Schlagworte: | SpCas9, SpyCas9, SPy_1046, CRISPR-associated endonuclease Cas9/Csn1, |
| Anwendung: | Knock-out generation, sgRNA screen implementation |
8.560,00 €
Cas9-Expressing A549 Cell line - Low expression
Artikelnummer: BPS-78134-L
This cell line is a clonal derivative from the Cas9-Expressing A549 Cell Pool (BPS-78072). It was generated by limited dilution of the original pool and isolation of individual clones, which were screened based on Cas9 expression to obtain a low-expressing cell line. The expressed Cas9 protein includes a C-terminal...
| Schlagworte: | SpCas9, SpyCas9, SPy_1046, CRISPR-associated endonuclease Cas9/Csn1, |
| Anwendung: | Knock-out generation, sgRNA screen implementation |
8.560,00 €
Media Required for Cell Culture Thaw Medium 2 (BPS...
Artikelnummer: BPS-78321
Recombinant CHO-K1 cells constitutively expressing human B7-H7 (also known as HHLA2: HERV-H LTR-associating protein 2, GenBank accession #NM_007072) and an engineered T cell receptor (TCR) activator. B7-H7 mediates an immune-stimulatory signal via TMIGD2 (Transmembrane and immunoglobulin domain containing 2) in...
| Schlagworte: | HERV-H LTR-associating protein 2, Human endogenous retrovirus-H long terminal repeat-associating protein 2, B7y, B7H7,... |
| Anwendung: | Biological activity characterization, antibody screening |
| Spezies-Reaktivität: | human |
14.049,00 €
CD7 CHO Cell Line (Medium or High Expression)-78324-H
Artikelnummer: BPS-78324-H
Recombinant CD7 CHO-K1 cell lines expressing full-length human CD7 receptor (accession number: NM_006137.6). Surface expression of human CD7 was confirmed by flow cytometry. Each stable clonal cell line was selected for high or medium levels of CD7 expression to mimic different stages of cancer target cells with...
| Schlagworte: | CD7, TP41, GP40, T-cell antigen CD7, T-cell leukemia antigen, T-cell surface antigen Leu-9, |
| Anwendung: | Compound screening, immunotherapy research, drug discovery, antibody/ligand characterization |
| Spezies-Reaktivität: | human |
9.308,00 €
CD7 CHO Cell Line (Medium or High Expression)-78324-M
Artikelnummer: BPS-78324-M
Recombinant CD7 CHO-K1 cell lines expressing full-length human CD7 receptor (accession number: NM_006137.6). Surface expression of human CD7 was confirmed by flow cytometry. Each stable clonal cell line was selected for high or medium levels of CD7 expression to mimic different stages of cancer target cells with...
| Schlagworte: | CD7, TP41, GP40, T-cell antigen CD7, T-cell leukemia antigen, T-cell surface antigen Leu-9, |
| Anwendung: | Compound screening, immunotherapy research, drug discovery, antibody/ligand characterization |
| Spezies-Reaktivität: | human |
9.308,00 €
