Biologische Proben

In den vergangenen Jahrzehnten wurden besonders in den Naturwissenschaften erstaunliche Durchbrüche erreicht und technische Fortschritte erzielt. Trotz dieser Errungenschaften bleiben biologische Systeme und die Produkte, die aus ihnen gewonnen werden, unersetzlich für die Forschung. Immortalisierte Zelllinien, Bakterien und Hefestämme sind das Herzstück und wichtigstes Werkzeug in der modernen Molekularbiologie und der medizinischen Forschung. Biologische Proben wie Blut und Blutprodukte, Lysate, Nukleinsäuren und Gewebeproben dienen als Kontrollen sowie als Forschungsobjekte in vielfältigen Experimenten und klinischen Tests.

Fenster schließen

Biologische Proben

Für die Filterung wurden keine Ergebnisse gefunden!

VISTA Stable Cell Line

Artikelnummer: ABE-14-516ACL

VISTA Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human V-type immunoglobulin domain-containing suppressor of T-cell activation (VISTA, also known as VSIR, B7-H5, PD-1H, and SISP1). Sequence data: hVISTA (accession number NM_022153) MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVC...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

mCD73 Stable Cell Line

Artikelnummer: ABE-14-517ACL

mCD73 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses mouse Cluster of Differentiation 73 (CD73 also known as ecto-5`-nucleotidase). Sequence data: mCD73 (accession number NM_011851) MRPAAAKVPKWLLLALSALLPQWPAASAWELTILHTNDVHSRLEQTSDDSTKCLNASLCV...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

GPC3 Stable Cell Line

Artikelnummer: ABE-14-518ACL

GPC3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Glypican 3 (GPC3, also known as GTR2-2, OCI-5 and MXR7). Sequence data: hGPC3 (accession number NM_004484) MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQR LQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKF...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

VISTA Stable Cell Line-H

Artikelnummer: ABE-14-519ACL

VISTA Stable Cell Line-H is a stably transfected HEK293 cell line which expresses human V-type immunoglobulin domain-containing suppressor of T-cell activation (VISTA, also known as VSIR, B7-H5, PD-1H, and SISP1). Sequence data: hVISTA (accession number NM_022153) MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVC...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

TIM-3 Stable Cell Line

Artikelnummer: ABE-14-520ACL

TIM-3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human T-cell immunoglobulin and mucin-domain containing-3 (TIM-3, also known as HAVCR2 and CD366). Sequence data: hTIM-3 (accession number NM_032782) MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAA...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

B7-H3 Stable Cell Line

Artikelnummer: ABE-14-521ACL

B7-H3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human B7-H3 (also known as CD276). Sequence data: hB7-H3 (accession number NM_001024736) MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGT DATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

A2AR Stable Cell Line

Artikelnummer: ABE-14-522ACL

A2AR Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human adenosine A2A receptor (A2AR, also known as ADORA2A). Sequence data: hA2AR (accession number BC013780) MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYF VVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDR...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

ACE2/CHO-K1 Stable Cell Line

Artikelnummer: ABE-14-523ACL

ACE2 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal amino...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

ACE2/HEK293 Stable Cell Line

Artikelnummer: ABE-14-524ACL

ACE2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal...

Anwendung:

4.103,00 €

Detailansicht

Bewerten

Cas9-Expressing A549 Cell line - High expression

Artikelnummer: BPS-78134-H

This cell line is a clonal derivative from the Cas9-Expressing A549 Cell Pool (BPS-78072). It was generated by limited dilution of the original pool and isolation of individual clones, which were screened based on Cas9 expression to obtain a high-expressing cell line. The expressed Cas9 protein includes a C-terminal...

Schlagworte:	SpCas9, SpyCas9, SPy_1046, CRISPR-associated endonuclease Cas9/Csn1,
Anwendung:	Knock-out generation, sgRNA screen implementation

8.560,00 €

Detailansicht

Bewerten

Cas9-Expressing A549 Cell line - Low expression

Artikelnummer: BPS-78134-L

This cell line is a clonal derivative from the Cas9-Expressing A549 Cell Pool (BPS-78072). It was generated by limited dilution of the original pool and isolation of individual clones, which were screened based on Cas9 expression to obtain a low-expressing cell line. The expressed Cas9 protein includes a C-terminal...

Schlagworte:	SpCas9, SpyCas9, SPy_1046, CRISPR-associated endonuclease Cas9/Csn1,
Anwendung:	Knock-out generation, sgRNA screen implementation

8.560,00 €

Detailansicht

Bewerten

Media Required for Cell Culture Thaw Medium 2 (BPS...

Artikelnummer: BPS-78321

Recombinant CHO-K1 cells constitutively expressing human B7-H7 (also known as HHLA2: HERV-H LTR-associating protein 2, GenBank accession #NM_007072) and an engineered T cell receptor (TCR) activator. B7-H7 mediates an immune-stimulatory signal via TMIGD2 (Transmembrane and immunoglobulin domain containing 2) in...

Schlagworte:	HERV-H LTR-associating protein 2, Human endogenous retrovirus-H long terminal repeat-associating protein 2, B7y, B7H7,...
Anwendung:	Biological activity characterization, antibody screening
Spezies-Reaktivität:	human

14.049,00 €

Detailansicht

Bewerten

224 von 228 Seiten