8 products were found matching "5488-1"!

No results were found for the filter!
AMB
AMB

Item number: Cay15488-1

AB-PINACA (Cay-14038) is a synthetic cannabinoid recently identified in illegal herbal products. AMB is an analog of AB-PINACA characterized by the replacement of a primary amine with a methoxy group. The physiological and toxicological properties of this compound have not been determined. This product is intended...
Keywords: AMB-PINACA, AMP, MMB-PINACA, N-[(1-pentyl-1H-indazol-3-yl)carbonyl]-L-valine, methyl ester
Application: Analytical reference standard, Synthetic cannabinoid AB-PINACA analog
CAS 1890250-13-1
MW: 345.4 D
From 84.00€ *
Review
Heptanoyl fentanyl (hydrochloride)
Heptanoyl fentanyl (hydrochloride)

Item number: Cay25488-1

Heptanoyl fentanyl (hydrochloride) (Cay-25488) is an analytical reference standard that is structurally similar to known opioids. Heptanoyl fentanyl is regulated as a Schedule I compound in the United States. This product is intended for research and forensic applications.Formal Name:...
Keywords: N-(1-phenethylpiperidin-4-yl)-N-phenylheptanamide
Application: Analytical reference standard, Structurally similar to known opioids
CAS 2749326-85-8
MW: 429 D
From 291.00€ *
Review
Rnf123, Mouse ring finger protein 123, Real Time PCR Primer Set
Rnf123, Mouse ring finger protein 123, Real Time PCR...

Item number: VMPS-5488

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Kpc1, Rnf123, EC=6.3.2.-, RING finger protein 123, E3 ubiquitin-protein ligase RNF123, Kip1 ubiquitination-promoting...
Application: RNA quantification
43.00€ *
Review
Sema5A, Rat sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain
Sema5A, Rat sema domain, seven thrombospondin repeats...

Item number: VRPS-5488

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Sema5a, RCG53309, rCG_53309
Application: RNA quantification
52.00€ *
Review
Anti-HMGB1 (High Mobility Group Protein 1, HMG-1) (APC)
Anti-HMGB1 (High Mobility Group Protein 1, HMG-1) (APC)

Item number: 145488.100

HMGB1 is a non-histone chromosomal protein that functions in endotoxin lethality. It is released from activated macrophages and is present at elevated levels in the serum of sepsis patients. HMGB1 was also reported to interact with RAGE (receptor for advanced glycation end products) and to influence neuron...
Application: FC
Host: Mouse
Species reactivity: human
843.00€ *
Review
Anti-14-3-3 gamma (14-3-3 Protein gamma, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAG)
Anti-14-3-3 gamma (14-3-3 Protein gamma, Protein Kinase C...

Item number: 135488.100

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH*, Storage and Stability: May be...
Application: ELISA, WB
Host: Mouse
Species reactivity: human, mouse, rat
699.00€ *
Review
Belotecan (hydrochloride)
Belotecan (hydrochloride)

Item number: Cay35488-10

Belotecan is an inhibitor of DNA topoisomerase I (IC50 = 0.119 µg/ml) and a derivative of the DNA topoisomerase I inhibitor camptothecin (Cay-11694). It inhibits the proliferation of various cancer cell lines, including KATO III stomach, HT-29 colon, A549 lung, MDA-MB-231 breast, and SKOV3 ovarian cancer cells...
Keywords: (S)-CKD602, 7-[2-(N-isopropylamino)ethyl]-(20S)-Camptothecin, CKD602,...
Application: DNA topoisomerase I inhibitor
CAS 213819-48-8
MW: 470 D
From 129.00€ *
Review
Anti-BGN / Biglycan
Anti-BGN / Biglycan

Item number: NSJ-F54881-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. BGN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached...
Keywords: Anti-BGN, Anti-PG-S1, Anti-SLRR1A, Anti-Biglycan, Anti-Bone/cartilage proteoglycan I, BGN Antibody / Biglycan
Application: FC, IHC (paraffin), WB
Host: Rabbit
Species reactivity: human
From 326.00€ *
Review