- Search results for 5894-1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
10 products were found matching "5894-1"!
Close filters
Filter by:
No results were found for the filter!
Item number: LKT-R5894.1
A histamine H2-receptor antagonist used in ulcer treatment. It is found to inhibit platelet function in vitro.
Application: | H2-receptor antagonist |
CAS | 93793-83-0 |
MW: | 384,9 D |
From 149.00€
*
Item number: E-AB-65894.120
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This...
Keywords: | Anti-STAT1, Anti-Transcription factor ISGF-3 components p91/p84, Anti-Signal transducer and activator of transcription... |
Application: | IF |
Host: | Rabbit |
Species reactivity: | human, mouse |
From 198.00€
*
Item number: Cay589401-1
Atriopeptin is a 28 amino acid peptide synthesized primarily in cardiac atria. This peptide hormone acts in opposition to angiotensin II in regulating renal, hemodynamic, and endocrine function. Atriopeptin is released in response to the increased pressure and mechanical stretch of the right atrium due to blood...
Keywords: | Atriopeptin (rat) ELISA Kit |
Application: | ELISA |
Species reactivity: | rat |
869.00€
*
Item number: Cay589451-1
N-Acetyl Ser-Asp-Lys-Pro (AcSDKP) is a tetrapeptide growth regulatory hormone which inhibits the proliferation of hematopoietic stem cells. The dipeptidase Angiotensin Converting Enzyme (ACE) actively metabolizes circulating AcSDKP, giving it a brief plasma half life of 4 to 5 minutes. ACE inhibition is a major...
Keywords: | N-Acetyl Ser-Asp-Lys-Pro ELISA Kit |
Application: | ELISA |
1,313.00€
*
Item number: VHPS-5894
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | MSH2, hMSH2, MutS protein homolog 2, DNA mismatch repair protein Msh2 |
Application: | RNA quantification |
43.00€
*
Item number: VMPS-5894
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Sirt7, Sir2l7, EC=3.5.1.-, SIR2-like protein 7, NAD-dependent deacetylase sirtuin-7 |
Application: | RNA quantification |
43.00€
*
Item number: ELK-ES5894.100
This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is...
Keywords: | Anti-NKSF1, Anti-IL12A, Anti-IL-12A, Anti-CLMF p35, Anti-IL-12 subunit p35, Anti-Interleukin-12 subunit alpha, Anti-NK... |
Application: | WB, IHC, IF, ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 169.00€
*
Item number: 245894.100
This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. [provided by RefSeq. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution:...
Application: | ELISA, WB |
Host: | Mouse |
Species reactivity: | human |
699.00€
*
Item number: E-AB-52894.120
The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a...
Keywords: | Anti-PTHR, Anti-PTH1R, Anti-PTH1 receptor, Anti-PTH/PTHr receptor, Anti-PTH/PTHrP type I receptor, Anti-Parathyroid... |
Application: | IHC, ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 71.00€
*
Item number: 375894.100
Source:, Recombinant protein corresponding to aa1-119 from human YPEL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD, AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE, Storage and Stability:...
Keywords: | FKSG3, YPEL1, Protein yippee-like 1 |
MW: | 29,6 |
From 511.00€
*