10 products were found matching "5894-1"!

No results were found for the filter!
Roxatidine acetate hydrochloride
Roxatidine acetate hydrochloride

Item number: LKT-R5894.1

A histamine H2-receptor antagonist used in ulcer treatment. It is found to inhibit platelet function in vitro.
Application: H2-receptor antagonist
CAS 93793-83-0
MW: 384,9 D
From 149.00€ *
Review
Anti-STAT1
Anti-STAT1

Item number: E-AB-65894.120

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This...
Keywords: Anti-STAT1, Anti-Transcription factor ISGF-3 components p91/p84, Anti-Signal transducer and activator of transcription...
Application: IF
Host: Rabbit
Species reactivity: human, mouse
From 198.00€ *
Review
Atriopeptin (rat) EIA Kit
Atriopeptin (rat) EIA Kit

Item number: Cay589401-1

Atriopeptin is a 28 amino acid peptide synthesized primarily in cardiac atria. This peptide hormone acts in opposition to angiotensin II in regulating renal, hemodynamic, and endocrine function. Atriopeptin is released in response to the increased pressure and mechanical stretch of the right atrium due to blood...
Keywords: Atriopeptin (rat) ELISA Kit
Application: ELISA
Species reactivity: rat
869.00€ *
Review
AcSDKP EIA Kit
AcSDKP EIA Kit

Item number: Cay589451-1

N-Acetyl Ser-Asp-Lys-Pro (AcSDKP) is a tetrapeptide growth regulatory hormone which inhibits the proliferation of hematopoietic stem cells. The dipeptidase Angiotensin Converting Enzyme (ACE) actively metabolizes circulating AcSDKP, giving it a brief plasma half life of 4 to 5 minutes. ACE inhibition is a major...
Keywords: N-Acetyl Ser-Asp-Lys-Pro ELISA Kit
Application: ELISA
1,313.00€ *
Review
MSH2, Human mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), Real Time PCR Primer Set
MSH2, Human mutS homolog 2, colon cancer, nonpolyposis...

Item number: VHPS-5894

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: MSH2, hMSH2, MutS protein homolog 2, DNA mismatch repair protein Msh2
Application: RNA quantification
43.00€ *
Review
Sirt7, Mouse sirtuin 7 (silent mating type information regulation 2, homolog) 7 (S. cerevisiae), Rea
Sirt7, Mouse sirtuin 7 (silent mating type information...

Item number: VMPS-5894

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Sirt7, Sir2l7, EC=3.5.1.-, SIR2-like protein 7, NAD-dependent deacetylase sirtuin-7
Application: RNA quantification
43.00€ *
Review
-10 %
Discount Promotion
Anti-IL-12A
Anti-IL-12A

Item number: ELK-ES5894.100

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is...
Keywords: Anti-NKSF1, Anti-IL12A, Anti-IL-12A, Anti-CLMF p35, Anti-IL-12 subunit p35, Anti-Interleukin-12 subunit alpha, Anti-NK...
Application: WB, IHC, IF, ELISA
Host: Rabbit
Species reactivity: human, mouse, rat
169.00€ * From 152.10€ *
Review
Anti-FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146)
Anti-FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823,...

Item number: 245894.100

This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. [provided by RefSeq. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution:...
Application: ELISA, WB
Host: Mouse
Species reactivity: human
699.00€ *
Review
Anti-PTH1R
Anti-PTH1R

Item number: E-AB-52894.120

The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a...
Keywords: Anti-PTHR, Anti-PTH1R, Anti-PTH1 receptor, Anti-PTH/PTHr receptor, Anti-PTH/PTHrP type I receptor, Anti-Parathyroid...
Application: IHC, ELISA
Host: Rabbit
Species reactivity: human, mouse, rat
From 71.00€ *
Review
YPEL1, Recombinant, Human, aa1-119, His-SUMO-Tag (Protein Yippee-like 1)
YPEL1, Recombinant, Human, aa1-119, His-SUMO-Tag (Protein...

Item number: 375894.100

Source:, Recombinant protein corresponding to aa1-119 from human YPEL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD, AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE, Storage and Stability:...
Keywords: FKSG3, YPEL1, Protein yippee-like 1
MW: 29,6
From 511.00€ *
Review