3 products were found matching "Pro-20113"!
No results were found for the filter!
Anti-ABRACL (Costars Family Protein ABRACL, ABRA...
Item number: 122835.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD, Storage and Stability: May be stored at 4°C for...
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*
CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)
Item number: E-PKSM041515.100
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <1 µg/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by...
| Keywords: | Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Recombinant Mouse... |
| Application: | Active, Cell culture |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 13.08 kD |
From 295.00€
*
CF(R)594 Goat Anti-Rabbit IgG (H+L), Highly...
Item number: BOT-20113
This product is prepared by labeling highly cross-adsorbed goat anti-rabbit IgG (H+L) with CF(R)594 dye. CF(R) dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Deep-red fluorescent CF(R)594 dye has...
| Keywords: | CF(R)594 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL, |
| Host: | Goat |
| Species reactivity: | rabbit |
From 143.00€
*
