Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
126715.50 | 50 µg | - | - |
3 - 19 business days* |
699.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box... more
Product information "Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F"
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box proteins are divided into 3 classes: FBWs containing WD-40 domains, FBLs containing leucine-rich repeats, and FBXs containing either different protein-protein interaction modules or no recognizable motifs. They constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. Cdc4 is one member of this family, which is also known as AGO, FBW7, FBX30 or SEL10. CDC4 binds directly to cyclin E and targets cyclin E for ubiquitin-mediated degradation. Cdc4 proteins of amino acid lengths varying from 553aa to 707aa in length have been reported. Cdc4 is an inhibitor of Notch signaling that targets Notch for ubiquitin-mediated degradation after a nuclear phosphorylation event. Cdc4 interacts with presenilin 1, facilitates its ubiquitination, and alters A-beta peptide production. Thus, it may be important for Alzheimer's disease. Mutations of the CDC4 gene are detected in ovarian and breast cancer cell lines and the CDC4 gene may also be involved in the pathogenesis of human pancreatic and endometrial cancers. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: | United States Biological |
Supplier-Nr: | 126715 |
Properties
Application: | IF, WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human |
Immunogen: | Full length human FBXW7, aa1-627 (NP_060785.2). |
Purity: | Purified by Protein A affinity chromatography. |
Format: | Affinity Purified |
Database Information
KEGG ID : | K10260 | Matching products |
UniProt ID : | Q969H0 | Matching products |
Gene ID | GeneID 55294 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed