No results were found for the filter!

Anti-ABRACL (Costars Family Protein ABRACL, ABRA...

Item number: 122835.100

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD, Storage and Stability: May be stored at 4°C for...

Application:	ELISA, WB
Host:	Mouse
Species reactivity:	human

699.00€ *

Show details

Review

Biotin Goat Anti-Mouse IgG (H+L), 2 mg/mL

Item number: BOT-20183

This product is prepared by labeling high quality goat anti-mouse IgG (H+L) with biotin. Concentration: 2 mg/mL Storage buffer: PBS, 50% glycerol, 2 mg/ml BSA, 0.05% azide

Keywords:	Biotin Goat Anti-Mouse IgG (H+L), 2 mg/mL,
Host:	Goat
Species reactivity:	mouse

From 115.00€ *

Show details

Review

Didn't find the right Product? Here are some useful Search Tips!

Checklist-Thumbnail

All our products have English titles and descriptions. Therefore, use English search terms.
Write out Greek letters - i.e. "alpha" instead of α or "beta" instead of β.
Do not add "and" when entering multiple search terms.
Use the singular (e.g. "antibody" instead of "antibodies").
If available, try synonyms (e.g. for a specific protein).
You can search for chemical substances using the unique CAS number (Chemical Abstracts Service).
In addition, you can also use the UniProt or KEGG accession number for the product search.
Use our filter function to narrow down your search results. If you want to remove a selected filter again, click on the small "x" next to the filter.
Are you looking for products from a specific supplier? Then enter the corresponding supplier name and select it in the appearing suggestion field. Alternatively, you can also use our supplier overview.
Use - if known - the specific product number. Especially for short numbers, note the supplier code in front of each number for most of our partners (e.g. for AAT Bioquest "ABD-121" instead of just "121"). Click on the button below to find all supplier codes and additional information.

All Supplier Codes

We would be very happy to support you in your product search! Contact us at info@biomol.com.

2 products were found matching "Pro-20183"!

Didn't find the right Product? Here are some useful Search Tips!