5 products were found matching "Pro-20143"!

No results were found for the filter!
Anti-DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16, DBP2, DDX16, PRO2014, PRP8)
Anti-DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16,...

Item number: 245330.50

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly....
Application: IF, WB
Host: Mouse
Species reactivity: human
699.00€ *
Review
Anti-ABRACL (Costars Family Protein ABRACL, ABRA C-terminal-like Protein, C6orf115, HSPC280, PRO2013
Anti-ABRACL (Costars Family Protein ABRACL, ABRA...

Item number: 122835.100

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD, Storage and Stability: May be stored at 4°C for...
Application: ELISA, WB
Host: Mouse
Species reactivity: human
699.00€ *
Review
Fibroblast Growth Factor 2/FGF-2/FGFb(Pro143-Ser288) Protein (recombinant human)
Fibroblast Growth Factor 2/FGF-2/FGFb(Pro143-Ser288)...

Item number: E-PKSH032439.10

Activity: Measured in a cell proliferation assay using BALB/c 3T3 cells.The ED50 for this effect is less than 5 ng/ml. Protein Construction: Recombinant Human Fibroblast growth factor 2/Fibroblast Growth Factor Basic is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed....
Keywords: bFGF, FGF2, FGFB, FGF-2, HBGF-2, Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor...
Expressed in: E.coli
Origin: human
MW: 16.3 kD
From 73.00€ *
Review
Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Pro143-Ser288)
Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb...

Item number: ABE-32-7634-10

Source: E.coli. MW :17.3kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed. FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many...
From 397.00€ *
Review
NEW
CF(R)350 Goat Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
CF(R)350 Goat Anti-Mouse IgG (H+L), Highly...

Item number: BOT-20143

This product is prepared by labeling highly cross-adsorbed goat anti-mouse IgG (H+L) with CF(R)350 dye. CF(R) dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. UV-excitable blue fluorescent CF(R)350...
Keywords: CF(R)350 Goat Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL,
Host: Goat
Species reactivity: mouse
From 143.00€ *
Review