- Search results for Pro-20143
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
4 products were found matching "Pro-20143"!
Close filters
Filter by:
No results were found for the filter!
Item number: 245330.50
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly....
Application: | IF, WB |
Host: | Mouse |
Species reactivity: | human |
699.00€
*
Item number: 122835.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD, Storage and Stability: May be stored at 4°C for...
Application: | ELISA, WB |
Host: | Mouse |
Species reactivity: | human |
699.00€
*
Item number: E-PKSH032439.10
Activity: Measured in a cell proliferation assay using BALB/c 3T3 cells.The ED50 for this effect is less than 5 ng/ml. Protein Construction: Recombinant Human Fibroblast growth factor 2/Fibroblast Growth Factor Basic is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed....
Keywords: | bFGF, FGF2, FGFB, FGF-2, HBGF-2, Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor... |
Expressed in: | E.coli |
Origin: | human |
MW: | 16.3 kD |
From 73.00€
*
Item number: ABE-32-7634-10
Source: E.coli. MW :17.3kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed. FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many...
From 397.00€
*