3 products were found matching "Pro-20132"!
No results were found for the filter!
PRO0132, Human, Real Time PCR Primer Set
Item number: VHPS-7272
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | GeneID 29034, qPCR, gene expression analysis |
| Application: | RNA quantification |
43.00€
*
Anti-ABRACL (Costars Family Protein ABRACL, ABRA...
Item number: 122835.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD, Storage and Stability: May be stored at 4°C for...
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*
PRO2012, Human, Real Time PCR Primer Set
Item number: VHPS-7308
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | GeneID 55478, qPCR, gene expression analysis |
| Application: | RNA quantification |
43.00€
*
