11 products were found matching "Pro-20232"!

This product is prepared by labeling highly cross-adsorbed goat anti-rabbit IgG (H+L) with CF(R)555 dye. CF(R) dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Orange-red fluorescent CF(R)555 dye...

PSCA (prostate stem cell antigen) is a glycosylphosphatidylinositol (GPI)­anchored cell surface protein of the Thy­1/Ly­6 family. PSCA is expressed in differentiating cells and epithelial cells of the prostate, bladder, kidney, skin, esophagus, stomach and placenta. It may be up­ or down­regulated in cancer and may...

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS*, Storage and Stability: May be stored at 4°C for short-term...

Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL, Storage and Stability:...

Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL, Storage and Stability:...

Control Peptide for 151511. Source: Synthetic peptide corresponding to 14aa from near the internal region of PSCA. Applications: Suitable for use in ELISA and Antibody Blocking. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be...

PSCA (Prostate Stem Cell antigen) is a cell surface antigen which is overexpressed in ~40% of primary prostate cancers and in nearly 100% of metastatic ones. PSCA is also overexpressed in a majority of transitional cell and pancreatic carcinomas. Antibody directed against PSCA inhibits tumorigenesis, slows tumor...

PSCA is a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. It is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and...

PSCA is a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. It is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and...