26 products were found matching "135888.100"!
No results were found for the filter!
Anti-Progesterone Receptor (NR3C3, PGR)
Item number: 138588.100
This monoclonal antibody is specific to progesterone receptor and shows minimal cross-reaction with other members of the family. Progesterone receptor is expressed as two major isoforms, PR-A (81kD) and PR-B (116kD). Expression of PgR has been suggested to reflect a intact estrogen regulatory machinery and...
| Application: | IHC, WB |
| Host: | Mouse |
| Species reactivity: | human |
From 439.00€
*
Anti-phospho-beta-catenin (Ser715) Antibody
Item number: ABE-35-1358-100
Key downstream component of the canonical Wnt signaling pathway. In the absence of Wnt, forms a complex with AXIN1, AXIN2, APC, CSNK1A1 and GSK3B that promotes phosphorylation on N-terminal Ser and Thr residues and ubiquitination of CTNNB1 via BTRC and its subsequent degradation by the proteasome. In the presence of...
| Keywords: | Anti-phospho-CTNNB, Anti-phospho-CTNNB1, Anti-phospho-Beta-catenin, Anti-phospho-Catenin beta-1, beta-catenin... |
| Application: | IHC, WB |
| Species reactivity: | rat, mouse, human |
682.00€
*
Anti-Cytokeratin 8 (KRT8)(H1 + TS1)
Item number: ABE-36-1358-100
Cytokeratin 8 (CK8) belongs to the type II (or B or basic) subfamily of high molecular weight cytokeratins and exists in combination with cytokeratin 18 (CK18). CK8 is primarily found in the non-squamous epithelia and is present in majority of adenocarcinomas and ductal carcinomas. It is absent in squamous cell...
| Keywords: | Anti-K8, Anti-CYK8, Anti-CK-8, Anti-KRT8, Anti-Keratin-8, Anti-Cytokeratin-8, Anti-Type-II keratin Kb8, Anti-Keratin, type... |
| Application: | FC, IF, IHC |
| Host: | Mouse |
| Species reactivity: | human |
853.00€
*
Anti-Ferritin, Light Chain (FTL) (Microglia Marker)...
Item number: BOT-BNC881388-100
Mammalian ferritins consist of 24 subunits made up of 2 types of polypeptide chains, ferritin heavy chain and ferritin light chain. Ferritin heavy chains catalyze the first step in iron storage, the oxidation of Fe (II), whereas ferritin light chains promote the nucleation of ferrihydrite, enabling storage of Fe...
| Keywords: | Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF488A conjugate, 0.1mg/mL, |
| Application: | IHC (paraffin) (verif.), WB (verif.) |
From 274.00€
*
Anti-ZWINT (ZW10 Interactor, ZW10-interacting Protein 1,...
Item number: 135848.100
This gene encodes a protein that is clearly involved in kinetochore function although an exact role is not known. It interacts with ZW10, another kinetochore protein, possibly regulating the association between ZW10 and kinetochores. The encoded protein localizes to prophase kinetochores before ZW10 does and it...
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
744.00€
*
Anti-14-3-3 gamma (14-3-3 Protein gamma, Protein Kinase C...
Item number: 135488.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH*, Storage and Stability: May be...
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human, mouse, rat |
699.00€
*
Anti-ZPLD1 (Zona Pellucida-like Domain-containing Protein...
Item number: 135828.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 1ng/ml, Optimal dilutions to be determined by the researcher. AA Sequence: WNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTW, Storage and...
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*
Anti-Tubulin beta-2A Chain (Tubulin beta Class IIa,...
Item number: 134888.100
Applications:, Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence:...
| Application: | ELISA, IF, WB |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*
Anti-WISP2 (WNT1-inducible-signaling Pathway Protein 2,...
Item number: 135388.100
Applications:, Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Application: | ELISA, IP, WB |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*
Anti-ZSCAN21 (Zinc Finger and SCAN Domain-containing...
Item number: 135838.100
Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
744.00€
*
Anti-ZNF69 (Zinc Finger Protein 69, Cos5, hZNF3)
Item number: 135788.100
Applications:, Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPCCSHRRCREDPGTSESQEMEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIK*, Storage and Stability: May be stored at 4°C for short-term only....
| Application: | ELISA |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*
Anti-ZNHIT3 (Zinc Finger HIT Domain-containing Protein 3,...
Item number: 135818.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*