3 products were found matching "Pro-20103"!
No results were found for the filter!
Anti-ABRACL (Costars Family Protein ABRACL, ABRA...
Item number: 122835.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD, Storage and Stability: May be stored at 4°C for...
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human |
699.00€
*
Anti-Caspase-3 (Pro and Active)
Item number: ABE-20-1039-50
Apoptosis, or programmed cell death, is a common property of all multicellular organisms. The current dogma of apoptosis suggests that the components of the core cell-death machinery are integral to cells and widely conserved across species. Caspases, a family of cysteinyl aspartate-specific proteases, are integral...
| Keywords: | Anti-Cpp32, Anti-Casp3, EC=3.4.22.56, Polyclonal antibody to Caspase-3 (Pro and Active) |
| Application: | IP, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | dog, rat, mouse, human |
373.00€
*
CF(R)568 Goat Anti-Rabbit IgG (H+L), Highly...
Item number: BOT-20103
This product is prepared by labeling highly cross-adsorbed goat anti-rabbit IgG (H+L) with CF(R)568 dye. CF(R) dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Red fluorescent CF(R)568 dye has...
| Keywords: | CF(R)568 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL, |
| Host: | Goat |
| Species reactivity: | rabbit |
From 143.00€
*
